Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.39kD).)

Mouse anti-Human MIF Monoclonal Antibody | anti-MIF antibody

MIF (Macrophage Migration Inhibitory Factor, Glycosylation-inhibiting Factor, GIF, L-dopachrome Isomerase, L-dopachrome Tautomerase, Phenylpyruvate Tautomerase, GLIF, MMIF) (FITC)

Gene Names
MIF; GIF; GLIF; MMIF
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MIF; Monoclonal Antibody; MIF (Macrophage Migration Inhibitory Factor; Glycosylation-inhibiting Factor; GIF; L-dopachrome Isomerase; L-dopachrome Tautomerase; Phenylpyruvate Tautomerase; GLIF; MMIF) (FITC); anti-MIF antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A10-4D3
Specificity
Recognizes human MIF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-MIF antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 1-10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-115 from human MIF (AAH00447.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.39kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.39kD).)

Western Blot (WB)

(Western Blot analysis of MIF expression in transfected 293T cell line by MIF monoclonal antibody. Lane 1: MIF transfected lysate (12.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MIF expression in transfected 293T cell line by MIF monoclonal antibody. Lane 1: MIF transfected lysate (12.5kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MIF on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma tissue. [antibody concentration 1-10ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MIF on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma tissue. [antibody concentration 1-10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of MIF transfected lysate using anti-MIF monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MIF rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of MIF transfected lysate using anti-MIF monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MIF rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged MIF is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MIF is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-MIF antibody
References
1. An HLA-Presented Fragment of Macrophage Migration Inhibitory Factor Is a Therapeutic Target for Invasive Breast Cancer. Hawkins O, Verma B, Lightfoot S, Jain R, Rawat A, McNair S, Caseltine S, Mojsilovic A, Gupta P, Neethling F, Almanza O, Dooley W, Hildebrand W, Weidanz J.J Immunol. 2011 Apr 22. 2. eIF3m expression influences the regulation of tumorigenesis-related genes in human colon cancer. Goh SH, Hong SH, Hong SH, Lee BC, Ju MH, Jeong JS, Cho YR, Kim IH, Lee YS.Oncogene. 2010 Sep 13.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
12,476 Da
NCBI Official Full Name
Homo sapiens macrophage migration inhibitory factor (glycosylation-inhibiting factor), mRNA
NCBI Official Synonym Full Names
macrophage migration inhibitory factor (glycosylation-inhibiting factor)
NCBI Official Symbol
MIF
NCBI Official Synonym Symbols
GIF; GLIF; MMIF
NCBI Protein Information
macrophage migration inhibitory factor
Protein Family

NCBI Description

This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]

Research Articles on MIF

Similar Products

Product Notes

The MIF (Catalog #AAA6148232) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MIF (Macrophage Migration Inhibitory Factor, Glycosylation-inhibiting Factor, GIF, L-dopachrome Isomerase, L-dopachrome Tautomerase, Phenylpyruvate Tautomerase, GLIF, MMIF) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MIF can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 1-10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MIF for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MIF, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.