Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MIF rabbit polyclonal antibody. Western Blot analysis of MIF expression in human kidney.)

Rabbit anti-Human MIF Polyclonal Antibody | anti-MIF antibody

MIF (Macrophage Migration Inhibitory Factor, Glycosylation-inhibiting Factor, GIF, L-dopachrome Isomerase, L-dopachrome Tautomerase, Phenylpyruvate Tautomerase, GLIF, MMIF) (HRP)

Gene Names
MIF; GIF; GLIF; MMIF
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MIF; Polyclonal Antibody; MIF (Macrophage Migration Inhibitory Factor; Glycosylation-inhibiting Factor; GIF; L-dopachrome Isomerase; L-dopachrome Tautomerase; Phenylpyruvate Tautomerase; GLIF; MMIF) (HRP); anti-MIF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MIF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-MIF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MIF, aa1-115 (NP_002406.1).
Immunogen Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MIF rabbit polyclonal antibody. Western Blot analysis of MIF expression in human kidney.)

Western Blot (WB) (MIF rabbit polyclonal antibody. Western Blot analysis of MIF expression in human kidney.)

Western Blot (WB)

(MIF rabbit polyclonal antibody. Western Blot analysis of MIF expression in Jurkat.)

Western Blot (WB) (MIF rabbit polyclonal antibody. Western Blot analysis of MIF expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of MIF expression in transfected 293T cell line by MIF polyclonal antibody. Lane 1: MIF transfected lysate (12.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MIF expression in transfected 293T cell line by MIF polyclonal antibody. Lane 1: MIF transfected lysate (12.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MIF antibody
MIF (macrophage migration inhibitory factor) was one of the first cytokine activities to be discovered and was initially described as a T cell-derived factor that inhibit the random migration of microphages. Recently, MIF was rediscovered as a pituitary hormone that acts as the counter-regulatory hormone for glucocorticoid action within the immune system. MIF was released from macrophages and T-cells in response to physiological concentrations of glucocorticoids. The secreted MIF counter-regulates the immunosuppressive effects of steroids on immune cell activation and cytokine production. MIF also plays a critical role in the host control of inflammation and immunity.
Product Categories/Family for anti-MIF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,476 Da
NCBI Official Full Name
macrophage migration inhibitory factor
NCBI Official Synonym Full Names
macrophage migration inhibitory factor (glycosylation-inhibiting factor)
NCBI Official Symbol
MIF
NCBI Official Synonym Symbols
GIF; GLIF; MMIF
NCBI Protein Information
macrophage migration inhibitory factor; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase
UniProt Protein Name
Macrophage migration inhibitory factor
Protein Family
UniProt Gene Name
MIF
UniProt Synonym Gene Names
GLIF; MMIF; MIF; GIF
UniProt Entry Name
MIF_HUMAN

NCBI Description

This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]

Uniprot Description

MIF: a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. Also acts as a phenylpyruvate tautomerase.

Protein type: Amino Acid Metabolism - tyrosine; Apoptosis; Cytokine; EC 5.3.3.12; Amino Acid Metabolism - phenylalanine; Cell development/differentiation; Isomerase; EC 5.3.2.1

Chromosomal Location of Human Ortholog: 22q11.23

Cellular Component: nucleoplasm; extracellular space; cell surface; cytoplasm; extracellular region; vesicle

Molecular Function: phenylpyruvate tautomerase activity; protein binding; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; cytokine activity; dopachrome isomerase activity; receptor binding; chemoattractant activity

Biological Process: DNA damage response, signal transduction by p53 class mediator; regulation of macrophage activation; positive regulation of lipopolysaccharide-mediated signaling pathway; carboxylic acid metabolic process; cell aging; negative regulation of cellular protein metabolic process; prostaglandin biosynthetic process; positive regulation of peptidyl-serine phosphorylation; positive regulation of MAP kinase activity; negative regulation of DNA damage response, signal transduction by p53 class mediator; cell proliferation; positive regulation of fibroblast proliferation; positive regulation of peptidyl-tyrosine phosphorylation; negative regulation of myeloid cell apoptosis; cell surface receptor linked signal transduction; negative regulation of mature B cell apoptosis; positive chemotaxis; positive regulation of B cell proliferation; innate immune response; inflammatory response; positive regulation of phosphorylation; negative regulation of apoptosis; positive regulation of cytokine secretion

Disease: Rheumatoid Arthritis, Systemic Juvenile

Research Articles on MIF

Similar Products

Product Notes

The MIF mif (Catalog #AAA6385471) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MIF (Macrophage Migration Inhibitory Factor, Glycosylation-inhibiting Factor, GIF, L-dopachrome Isomerase, L-dopachrome Tautomerase, Phenylpyruvate Tautomerase, GLIF, MMIF) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MIF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MIF mif for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MIF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.