Mouse anti-Human MerTK Monoclonal Antibody | anti-MerTK antibody

MerTK (c-MER, c-Mer Proto-oncogene Tyrosine Kinase, MER, MER Receptor Tyrosine Kinase, MGC133349, Proto-oncogene c-Mer, RP38, Tyrosine-protein Kinase Mer) (MaxLight 650)

Cat. Num. AAA6223175

• Gene Names: MERTK; MER; RP38; c-mer
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MerTK; Monoclonal Antibody; MerTK (c-MER; c-Mer Proto-oncogene Tyrosine Kinase; MER; MER Receptor Tyrosine Kinase; MGC133349; Proto-oncogene c-Mer; RP38; Tyrosine-protein Kinase Mer) (MaxLight 650); anti-MerTK antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2D2
• Specificity: Recognizes human MERTK.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

• Applicable Applications for anti-MerTK antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa21-120 from human MERTK with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSINVP
• Conjugate: MaxLight650
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MERTK is 1ng/ml using129586 as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen using129586 (37kD).)

Related Product Information for anti-MerTK antibody

Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains.

Product Categories/Family for anti-MerTK antibody

Antibodies; Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 66932918
• NCBI GeneID: 10461
• NCBI Accession #: NP_006334
• NCBI GenBank Nucleotide #: NM_006343
• UniProt Accession #: Q12866; Q9HBB4
• Molecular Weight: 110,249 Da
• NCBI Official Full Name: tyrosine-protein kinase Mer
• NCBI Official Synonym Full Names: c-mer proto-oncogene tyrosine kinase
• NCBI Official Symbol: MERTK
• NCBI Official Synonym Symbols: MER; RP38; c-mer
• NCBI Protein Information: tyrosine-protein kinase Mer; STK kinase; proto-oncogene c-Mer; MER receptor tyrosine kinase; receptor tyrosine kinase MerTK
• UniProt Protein Name: Tyrosine-protein kinase Mer
• Protein Family: Tyrosine-protein kinase
• UniProt Gene Name: MERTK
• UniProt Synonym Gene Names: MER
• UniProt Entry Name: MERTK_HUMAN

Uniprot Description

Mer: a proto-oncogene receptor tyrosine-protein kinase of the Axl family. Binds several ligands including LGALS3, Tubby, TULP1 or GAS6. Regulates many physiological processes including cell survival, migration, differentiation, and phagocytosis of apoptotic cells (efferocytosis). Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3

Protein type: Protein kinase, TK; EC 2.7.10.1; Oncoprotein; Membrane protein, integral; Kinase, protein; Protein kinase, tyrosine (receptor); TK group; Axl family

Chromosomal Location of Human Ortholog: 2q14.1

Cellular Component: extracellular space; photoreceptor outer segment; integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: protein binding; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: platelet activation; negative regulation of lymphocyte activation; peptidyl-tyrosine phosphorylation; vagina development; protein amino acid phosphorylation; phagocytosis; cell surface receptor linked signal transduction; cell-cell signaling; natural killer cell differentiation; retina development in camera-type eye; positive regulation of phagocytosis; protein kinase B signaling cascade; spermatogenesis; blood coagulation; leukocyte migration; apoptotic cell clearance; secretion by cell

Disease: Retinitis Pigmentosa 38