Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged MERTK is 1ng/ml using129586 as a capture antibody.)

Mouse anti-Human MerTK Monoclonal Antibody | anti-MerTK antibody

MerTK (c-MER, c-Mer Proto-oncogene Tyrosine Kinase, MER, MER Receptor Tyrosine Kinase, MGC133349, Proto-oncogene c-Mer, RP38, Tyrosine-protein Kinase Mer) (MaxLight 550)

Gene Names
MERTK; MER; RP38; c-mer
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MerTK; Monoclonal Antibody; MerTK (c-MER; c-Mer Proto-oncogene Tyrosine Kinase; MER; MER Receptor Tyrosine Kinase; MGC133349; Proto-oncogene c-Mer; RP38; Tyrosine-protein Kinase Mer) (MaxLight 550); anti-MerTK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D2
Specificity
Recognizes human MERTK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-MerTK antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa21-120 from human MERTK with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTVGHIILSEHKGVKFNCSINVP
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MERTK is 1ng/ml using129586 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MERTK is 1ng/ml using129586 as a capture antibody.)

Western Blot (WB)

(Western Blot detection against Immunogen using129586 (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen using129586 (37kD).)
Related Product Information for anti-MerTK antibody
Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. With more than 500 gene products, the protein kinase family is one of the largest families of proteins in eukaryotes. The family has been classified in 8 major groups based on sequence comparison of their tyrosine (PTK) or serine/threonine (STK) kinase catalytic domains.
Product Categories/Family for anti-MerTK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
110,249 Da
NCBI Official Full Name
tyrosine-protein kinase Mer
NCBI Official Synonym Full Names
c-mer proto-oncogene tyrosine kinase
NCBI Official Symbol
MERTK
NCBI Official Synonym Symbols
MER; RP38; c-mer
NCBI Protein Information
tyrosine-protein kinase Mer; STK kinase; proto-oncogene c-Mer; MER receptor tyrosine kinase; receptor tyrosine kinase MerTK
UniProt Protein Name
Tyrosine-protein kinase Mer
Protein Family
UniProt Gene Name
MERTK
UniProt Synonym Gene Names
MER
UniProt Entry Name
MERTK_HUMAN

Uniprot Description

Mer: a proto-oncogene receptor tyrosine-protein kinase of the Axl family. Binds several ligands including LGALS3, Tubby, TULP1 or GAS6. Regulates many physiological processes including cell survival, migration, differentiation, and phagocytosis of apoptotic cells (efferocytosis). Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3

Protein type: Protein kinase, TK; EC 2.7.10.1; Oncoprotein; Membrane protein, integral; Kinase, protein; Protein kinase, tyrosine (receptor); TK group; Axl family

Chromosomal Location of Human Ortholog: 2q14.1

Cellular Component: extracellular space; photoreceptor outer segment; integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: protein binding; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: platelet activation; negative regulation of lymphocyte activation; peptidyl-tyrosine phosphorylation; vagina development; protein amino acid phosphorylation; phagocytosis; cell surface receptor linked signal transduction; cell-cell signaling; natural killer cell differentiation; retina development in camera-type eye; positive regulation of phagocytosis; protein kinase B signaling cascade; spermatogenesis; blood coagulation; leukocyte migration; apoptotic cell clearance; secretion by cell

Disease: Retinitis Pigmentosa 38

Similar Products

Product Notes

The MerTK mertk (Catalog #AAA6212500) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MerTK (c-MER, c-Mer Proto-oncogene Tyrosine Kinase, MER, MER Receptor Tyrosine Kinase, MGC133349, Proto-oncogene c-Mer, RP38, Tyrosine-protein Kinase Mer) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MerTK can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MerTK mertk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MerTK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.