Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.6kD).)

Mouse anti-Human MED8 Monoclonal Antibody | anti-MED8 antibody

MED8 (Mediator of RNA Polymerase II Transcription Subunit 8, Activator-recruited Cofactor 32kD Component, Mediator Complex Subunit 8, MGC17544, MGC19641) (HRP)

Gene Names
MED8; ARC32
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MED8; Monoclonal Antibody; MED8 (Mediator of RNA Polymerase II Transcription Subunit 8; Activator-recruited Cofactor 32kD Component; Mediator Complex Subunit 8; MGC17544; MGC19641) (HRP); anti-MED8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D3
Specificity
Recognizes human MED8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-MED8 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-60 from human MED8 (NP_443109) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.6kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.6kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MED8 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MED8 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged MED8 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MED8 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-MED8 antibody
This gene encodes a protein that is one of more than 20 subunits of the mediator complex, first identified in S. cerevisiae, that is required for activation of transcription. The product of this gene also interacts with elongins B and C, and CUL2 and RBX1, to reconstitute a ubiquitin ligase. Two alternative transcripts encoding different isoforms have been described.
Product Categories/Family for anti-MED8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,002 Da
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 8 isoform 3
NCBI Official Synonym Full Names
mediator complex subunit 8
NCBI Official Symbol
MED8
NCBI Official Synonym Symbols
ARC32
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 8; activator-recruited cofactor 32 kDa component; mediator of RNA polymerase II transcription subunit MED8
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 8
UniProt Gene Name
MED8
UniProt Synonym Gene Names
ARC32
UniProt Entry Name
MED8_HUMAN

Uniprot Description

MED8: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May play a role as a target recruitment subunit in E3 ubiquitin-protein ligase complexes and thus in ubiquitination and subsequent proteasomal degradation of target proteins. Belongs to the Mediator complex subunit 8 family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1p34.2

Cellular Component: nucleoplasm; Srb-mediator complex

Molecular Function: protein binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; protein ubiquitination; gene expression

Similar Products

Product Notes

The MED8 med8 (Catalog #AAA6153487) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MED8 (Mediator of RNA Polymerase II Transcription Subunit 8, Activator-recruited Cofactor 32kD Component, Mediator Complex Subunit 8, MGC17544, MGC19641) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MED8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MED8 med8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MED8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.