Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged MED13L is 0.03 ng/ml as a capture antibody.)

Mouse MED13L Monoclonal Antibody | anti-MED13L antibody

MED13L (Mediator Complex Subunit 13-like, DKFZp781D0112, FLJ21627, KIAA1025, PROSIT240, THRAP2, TRAP240L) (FITC)

Gene Names
MED13L; MRFACD; THRAP2; TRAP240L; PROSIT240
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
MED13L; Monoclonal Antibody; MED13L (Mediator Complex Subunit 13-like; DKFZp781D0112; FLJ21627; KIAA1025; PROSIT240; THRAP2; TRAP240L) (FITC); Mediator Complex Subunit 13-like; TRAP240L; anti-MED13L antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H2
Specificity
Recognizes MED13L.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
2210
Applicable Applications for anti-MED13L antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
MED13L (NP_056150, 1186aa-1285aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IFGKNSDIGQAAERRLMMCQSTFLPQVEGTKKPQEPPISLLLLLQNQHTQPFASLNFLDYISSNNRQTLPCVSWSYDRVQADNNDYWTECFNALEQGRQY
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MED13L is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MED13L is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-MED13L antibody
The evolutionarily conserved THRAP genes encode a family of proteins that regulate embryonic development. THRAP2 is involved in early development of the heart and brain (Muncke et al., 2003 [PubMed 14638541]). [supplied by OMIM]
Product Categories/Family for anti-MED13L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 13-like
NCBI Official Synonym Full Names
mediator complex subunit 13L
NCBI Official Symbol
MED13L
NCBI Official Synonym Symbols
MRFACD; THRAP2; TRAP240L; PROSIT240
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 13-like
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 13-like
UniProt Gene Name
MED13L
UniProt Synonym Gene Names
KIAA1025; PROSIT240; THRAP2; TRAP240L
UniProt Entry Name
MD13L_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of the Mediator complex, a large complex of proteins that functions as a transcriptional coactivator for most RNA polymerase II-transcribed genes. The encoded protein is involved in early development of the heart and brain. Defects in this gene are a cause of transposition of the great arteries, dextro-looped (DTGA).[provided by RefSeq, Jul 2010]

Uniprot Description

THRAP2: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. This subunit may specifically regulate transcription of targets of the Wnt signaling pathway and SHH signaling pathway. Defects in MED13L are a cause of transposition of the great arteries dextro-looped type 1 (DTGA1). A congenital heart defect consisting of complete inversion of the great vessels, so that the aorta incorrectly arises from the right ventricle and the pulmonary artery incorrectly arises from the left ventricle. This creates completely separate pulmonary and systemic circulatory systems, an arrangement that is incompatible with life. Patients often have atrial and/or ventricular septal defects or other types of shunting that allow some mixing between the circulations in order to support life minimally, but surgical intervention is always required. A chromosomal aberration involving MED13L is found in a patient with transposition of the great arteries, dextro- looped and mental retardation. Translocation t(12;17)(q24.1;q21). Belongs to the Mediator complex subunit 13 family.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 12q24.21

Cellular Component: Srb-mediator complex

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter

Disease: Transposition Of The Great Arteries, Dextro-looped 1

Research Articles on MED13L

Similar Products

Product Notes

The MED13L med13l (Catalog #AAA6179134) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MED13L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MED13L med13l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MED13L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.