Mouse MED13L Monoclonal Antibody | anti-MED13L antibody

MED13L (Mediator Complex Subunit 13-like, DKFZp781D0112, FLJ21627, KIAA1025, PROSIT240, THRAP2, TRAP240L) (HRP)

Cat. Num. AAA6183544

• Gene Names: MED13L; MRFACD; THRAP2; TRAP240L; PROSIT240
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: MED13L; Monoclonal Antibody; MED13L (Mediator Complex Subunit 13-like; DKFZp781D0112; FLJ21627; KIAA1025; PROSIT240; THRAP2; TRAP240L) (HRP); Mediator Complex Subunit 13-like; TRAP240L; anti-MED13L antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H2
• Specificity: Recognizes MED13L.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 2210

• Applicable Applications for anti-MED13L antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MED13L (NP_056150, 1186aa-1285aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IFGKNSDIGQAAERRLMMCQSTFLPQVEGTKKPQEPPISLLLLLQNQHTQPFASLNFLDYISSNNRQTLPCVSWSYDRVQADNNDYWTECFNALEQGRQY
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MED13L is 0.03 ng/ml as a capture antibody.)

Product Categories/Family for anti-MED13L antibody

Antibodies; Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 44771211
• NCBI GeneID: 23389
• NCBI Accession #: NP_056150
• NCBI GenBank Nucleotide #: NP_056150.1
• UniProt Accession #: Q71F56
• NCBI Official Full Name: mediator of RNA polymerase II transcription subunit 13-like
• NCBI Official Synonym Full Names: mediator complex subunit 13L
• NCBI Official Symbol: MED13L
• NCBI Official Synonym Symbols: MRFACD; THRAP2; TRAP240L; PROSIT240
• NCBI Protein Information: mediator of RNA polymerase II transcription subunit 13-like
• UniProt Protein Name: Mediator of RNA polymerase II transcription subunit 13-like
• Protein Family: Mediator of RNA polymerase II transcription
• UniProt Gene Name: MED13L
• UniProt Synonym Gene Names: KIAA1025; PROSIT240; THRAP2; TRAP240L
• UniProt Entry Name: MD13L_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of the Mediator complex, a large complex of proteins that functions as a transcriptional coactivator for most RNA polymerase II-transcribed genes. The encoded protein is involved in early development of the heart and brain. Defects in this gene are a cause of transposition of the great arteries, dextro-looped (DTGA).[provided by RefSeq, Jul 2010]

Uniprot Description

THRAP2: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. This subunit may specifically regulate transcription of targets of the Wnt signaling pathway and SHH signaling pathway. Defects in MED13L are a cause of transposition of the great arteries dextro-looped type 1 (DTGA1). A congenital heart defect consisting of complete inversion of the great vessels, so that the aorta incorrectly arises from the right ventricle and the pulmonary artery incorrectly arises from the left ventricle. This creates completely separate pulmonary and systemic circulatory systems, an arrangement that is incompatible with life. Patients often have atrial and/or ventricular septal defects or other types of shunting that allow some mixing between the circulations in order to support life minimally, but surgical intervention is always required. A chromosomal aberration involving MED13L is found in a patient with transposition of the great arteries, dextro- looped and mental retardation. Translocation t(12;17)(q24.1;q21). Belongs to the Mediator complex subunit 13 family.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 12q24.21

Cellular Component: Srb-mediator complex

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter

Disease: Transposition Of The Great Arteries, Dextro-looped 1