Mouse anti-Human MDR1 Monoclonal Antibody | anti-MDR1 antibody
MDR1 (Multidrug Resistance Protein 1, ABC20, ATP-binding Cassette Sub-family B Member 1, ABCB1, CD243, CLCS, GP170, MGC163296, P-glycoprotein 1, P-GP, PGY1, MGC163296) (MaxLight 650)
Gene Names
ABCB1; CLCS; MDR1; P-GP; PGY1; ABC20; CD243; GP170
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MDR1; Monoclonal Antibody; MDR1 (Multidrug Resistance Protein 1; ABC20; ATP-binding Cassette Sub-family B Member 1; ABCB1; CD243; CLCS; GP170; MGC163296; P-glycoprotein 1; P-GP; PGY1; MGC163296) (MaxLight 650); anti-MDR1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F11
Specificity
Recognizes human ABCB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-MDR1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa620-710 from ABCB1 (NP_000918) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWP
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MDR1 antibody
The Human multidrug resistance gene MDR1 encodes a membrane-bound protein, referred to as P-glycoprotein that acts as a pump to extrude toxins from cells. The 3' untranslated region (3'UTR) of the Human MDR1 mRNA is very AU-rich (70%). MDR1 is a member of the super family of ATP-binding cassette (ABC) transporters. MDR1 is a member of the MDR/TAP subfamily. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. It is expressed in Human liver, kidney, small intestine and brain. It is localized to Human chromosome 7q21.1.
Product Categories/Family for anti-MDR1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
141,479 Da
NCBI Official Full Name
multidrug resistance protein 1
NCBI Official Synonym Full Names
ATP-binding cassette, sub-family B (MDR/TAP), member 1
NCBI Official Symbol
ABCB1
NCBI Official Synonym Symbols
CLCS; MDR1; P-GP; PGY1; ABC20; CD243; GP170
NCBI Protein Information
multidrug resistance protein 1; P-glycoprotein 1; colchicin sensitivity; doxorubicin resistance
UniProt Protein Name
ATP-binding cassette, sub-family B (MDR/TAP), member 1
Protein Family
UniProt Gene Name
ABCB1
UniProt Entry Name
A4D1D2_HUMAN
Similar Products
Product Notes
The MDR1 abcb1 (Catalog #AAA6223153) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MDR1 (Multidrug Resistance Protein 1, ABC20, ATP-binding Cassette Sub-family B Member 1, ABCB1, CD243, CLCS, GP170, MGC163296, P-glycoprotein 1, P-GP, PGY1, MGC163296) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MDR1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MDR1 abcb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MDR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
