Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human MCF2L Monoclonal Antibody | anti-MCF2L antibody

MCF2L (DRG, KIAA0861, Probable Guanine Nucleotide Exchange Factor MCF2L2, Dbs-related Rho Family Guanine Nucleotide Exchange Factor, MCF2-transforming Sequence-like Protein 2) (HRP)

Gene Names
MCF2L; DBS; OST; ARHGEF14
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MCF2L; Monoclonal Antibody; MCF2L (DRG; KIAA0861; Probable Guanine Nucleotide Exchange Factor MCF2L2; Dbs-related Rho Family Guanine Nucleotide Exchange Factor; MCF2-transforming Sequence-like Protein 2) (HRP); anti-MCF2L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D11
Specificity
Recognizes human MCF2L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-MCF2L antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa220-320 from MCF2L (AAH20208) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GTELAETELPNDVQSTSSVLCAHTEKKDKAKEDLRLALKEGHSVLESLRELQAEGSEPSVNQDQLDNQATVQRLLAQLNETEAAFDEFWAKHQQKLEQCL*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MCF2L on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MCF2L on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MCF2L is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MCF2L is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-MCF2L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
126,111 Da
NCBI Official Full Name
Homo sapiens MCF.2 cell line derived transforming sequence-like, mRNA
NCBI Official Synonym Full Names
MCF.2 cell line derived transforming sequence like
NCBI Official Symbol
MCF2L
NCBI Official Synonym Symbols
DBS; OST; ARHGEF14
NCBI Protein Information
guanine nucleotide exchange factor DBS

NCBI Description

This gene encodes a guanine nucleotide exchange factor that interacts specifically with the GTP-bound Rac1 and plays a role in the Rho/Rac signaling pathways. A variant in this gene was associated with osteoarthritis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Research Articles on MCF2L

Similar Products

Product Notes

The MCF2L (Catalog #AAA6153464) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MCF2L (DRG, KIAA0861, Probable Guanine Nucleotide Exchange Factor MCF2L2, Dbs-related Rho Family Guanine Nucleotide Exchange Factor, MCF2-transforming Sequence-like Protein 2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MCF2L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MCF2L for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MCF2L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.