Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.08kD).)

Mouse anti-Human MBD1 Monoclonal Antibody | anti-MBD1 antibody

MBD1 (Methyl-CpG-binding Domain 1, PCM1, Methyl-CpG-binding Protein MBD1, Protein Containing Methyl-CpG-binding Domain 1, CXXC-type Zinc Finger Protein 3, CXXC3, PCM1) (PE)

Gene Names
MBD1; RFT; PCM1; CXXC3
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MBD1; Monoclonal Antibody; MBD1 (Methyl-CpG-binding Domain 1; PCM1; Methyl-CpG-binding Protein MBD1; Protein Containing Methyl-CpG-binding Domain 1; CXXC-type Zinc Finger Protein 3; CXXC3; PCM1) (PE); anti-MBD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2C7
Specificity
Recognizes human MBD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
605
Applicable Applications for anti-MBD1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa415-508 from human MBD1 (NP_056671) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.08kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.08kD).)

Western Blot (WB)

(MBD1 monoclonal antibody. Western Blot analysis of MBD1 expression in IMR-32.)

Western Blot (WB) (MBD1 monoclonal antibody. Western Blot analysis of MBD1 expression in IMR-32.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to MBD1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to MBD1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged MBD1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MBD1 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-MBD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
methyl-CpG-binding domain protein 1 isoform 1
NCBI Official Synonym Full Names
methyl-CpG binding domain protein 1
NCBI Official Symbol
MBD1
NCBI Official Synonym Symbols
RFT; PCM1; CXXC3
NCBI Protein Information
methyl-CpG-binding domain protein 1
UniProt Protein Name
Methyl-CpG-binding domain protein 1
UniProt Gene Name
MBD1
UniProt Synonym Gene Names
CXXC3; PCM1
UniProt Entry Name
MBD1_HUMAN

NCBI Description

The protein encoded by this gene is a member of a family of nuclear proteins related by the presence of a methyl-CpG binding domain (MBD). These proteins are capable of binding specifically to methylated DNA, and some members can also repress transcription from methylated gene promoters. This protein contains multiple domains: MBD at the N-terminus that functions both in binding to methylated DNA and in protein interactions; several CXXC-type zinc finger domains that mediate binding to non-methylated CpG dinucleotides; transcriptional repression domain (TRD) at the C-terminus that is involved in transcription repression and in protein interactions. Numerous alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Feb 2011]

Research Articles on MBD1

Similar Products

Product Notes

The MBD1 mbd1 (Catalog #AAA6158756) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MBD1 (Methyl-CpG-binding Domain 1, PCM1, Methyl-CpG-binding Protein MBD1, Protein Containing Methyl-CpG-binding Domain 1, CXXC-type Zinc Finger Protein 3, CXXC3, PCM1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MBD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MBD1 mbd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MBD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.