Mouse MBD1 Monoclonal Antibody | anti-MBD1 antibody

MBD1 (methyl-CpG Binding Domain Protein 1, CXXC3, PCM1, RFT) (HRP)

Cat. Num. AAA6181669

• Gene Names: MBD1; RFT; PCM1; CXXC3
• Applications: Western Blot
• Purity: Purified
• Synonyms: MBD1; Monoclonal Antibody; MBD1 (methyl-CpG Binding Domain Protein 1; CXXC3; PCM1; RFT) (HRP); methyl-CpG Binding Domain Protein 1; RFT; anti-MBD1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2B10
• Specificity: Recognizes MBD1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 605

• Applicable Applications for anti-MBD1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MBD1 (NP_056671, 415aa-508aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MBD1 monoclonal antibody (M05), clone 2B10. Western Blot analysis of MBD1 expression in Jurkat (Cat # L017V1).)

Western Blot (WB)

(MBD1 monoclonal antibody (M05), clone 2B10. Western Blot analysis of MBD1 expression in human kidney.)

Testing Data

(Detection limit for recombinant GST tagged MBD1 is 0.3 ng/ml as a capture antibody.)

Product Categories/Family for anti-MBD1 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21464117
• NCBI GeneID: 4152
• NCBI Accession #: NP_056671
• NCBI GenBank Nucleotide #: NP_056671.2
• UniProt Accession #: Q9UIS9
• NCBI Official Full Name: methyl-CpG-binding domain protein 1 isoform 1
• NCBI Official Synonym Full Names: methyl-CpG binding domain protein 1
• NCBI Official Symbol: MBD1
• NCBI Official Synonym Symbols: RFT; PCM1; CXXC3
• NCBI Protein Information: methyl-CpG-binding domain protein 1
• UniProt Protein Name: Methyl-CpG-binding domain protein 1
• Protein Family: Methyl-CpG-binding domain protein
• UniProt Gene Name: MBD1
• UniProt Synonym Gene Names: CXXC3; PCM1
• UniProt Entry Name: MBD1_HUMAN

NCBI Description

The protein encoded by this gene is a member of a family of nuclear proteins related by the presence of a methyl-CpG binding domain (MBD). These proteins are capable of binding specifically to methylated DNA, and some members can also repress transcription from methylated gene promoters. This protein contains multiple domains: MBD at the N-terminus that functions both in binding to methylated DNA and in protein interactions; several CXXC-type zinc finger domains that mediate binding to non-methylated CpG dinucleotides; transcriptional repression domain (TRD) at the C-terminus that is involved in transcription repression and in protein interactions. Numerous alternatively spliced transcript variants encoding different isoforms have been noted for this gene.[provided by RefSeq, Feb 2011]