Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human MARK3 Monoclonal Antibody | anti-MARK3 antibody

MARK3 (MAP/Microtubule Affinity-regulating Kinase 3, Cdc25C-associated Protein Kinase 1, cTAK1, C-TAK1, ELKL Motif Kinase 2, EMK2, EMK-2, KP78, Protein Kinase STK10, Ser/Thr Protein Kinase PAR-1, PAR1A, Par-1a, Serine/Threonine-protein Kinase p78) (AP)

Gene Names
MARK3; KP78; CTAK1; PAR1A; Par-1a
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MARK3; Monoclonal Antibody; MARK3 (MAP/Microtubule Affinity-regulating Kinase 3; Cdc25C-associated Protein Kinase 1; cTAK1; C-TAK1; ELKL Motif Kinase 2; EMK2; EMK-2; KP78; Protein Kinase STK10; Ser/Thr Protein Kinase PAR-1; PAR1A; Par-1a; Serine/Threonine-protein Kinase p78) (AP); anti-MARK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1A10
Specificity
Recognizes human MARK3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MARK3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa402-500 from human MARK3 (NP_002367.4) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HHKVQRSVFSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of MARK3 expression in transfected 293T cell line by MARK3 monoclonal antibody. Lane 1: MARK3 transfected lysate (81.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MARK3 expression in transfected 293T cell line by MARK3 monoclonal antibody. Lane 1: MARK3 transfected lysate (81.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MARK3 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MARK3 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-MARK3 antibody
Involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C on 'Ser-216'. Regulates localization and activity of some histone deacetylases by mediating phosphorylation of HDAC7, promoting subsequent interaction between HDAC7 and 14-3-3 and export from the nucleus.
Product Categories/Family for anti-MARK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74,151 Da
NCBI Official Full Name
MAP/microtubule affinity-regulating kinase 3 isoform c
NCBI Official Synonym Full Names
MAP/microtubule affinity-regulating kinase 3
NCBI Official Symbol
MARK3
NCBI Official Synonym Symbols
KP78; CTAK1; PAR1A; Par-1a
NCBI Protein Information
MAP/microtubule affinity-regulating kinase 3; EMK-2; C-TAK1; ELKL motif kinase 2; protein kinase STK10; ser/Thr protein kinase PAR-1; cdc25C-associated protein kinase 1; serine/threonine-protein kinase p78
UniProt Protein Name
MAP/microtubule affinity-regulating kinase 3
UniProt Gene Name
MARK3
UniProt Synonym Gene Names
CTAK1; EMK2; cTAK1; EMK-2; Par-1a
UniProt Entry Name
MARK3_HUMAN

NCBI Description

The protein encoded by this gene is activated by phosphorylation and in turn is involved in the phosphorylation of tau proteins MAP2 and MAP4. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

MARK3: an ubiquitous serine/threonine kinase of the CAMKL family. Phosphorylates Cdc25C on serine 216 and promotes 14-3-3 protein binding. A positive regulator of Wnt signalling. Ubiquitously expressed in human tissues and cell lines. Seven alternatively spliced isoforms have been reported.

Protein type: EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, CAMK; CAMK group; CAMKL family; MARK subfamily

Chromosomal Location of Human Ortholog: 14q32.32

Cellular Component: plasma membrane

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: protein amino acid phosphorylation

Research Articles on MARK3

Similar Products

Product Notes

The MARK3 mark3 (Catalog #AAA6132231) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MARK3 (MAP/Microtubule Affinity-regulating Kinase 3, Cdc25C-associated Protein Kinase 1, cTAK1, C-TAK1, ELKL Motif Kinase 2, EMK2, EMK-2, KP78, Protein Kinase STK10, Ser/Thr Protein Kinase PAR-1, PAR1A, Par-1a, Serine/Threonine-protein Kinase p78) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MARK3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MARK3 mark3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MARK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.