Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for 129421 is 0.3ng/ml as a capture antibody.)

Mouse anti-Human MAPRE1 Monoclonal Antibody | anti-MAPRE1 antibody

MAPRE1 (Microtubule-associated Protein RP/EB Family Member 1, APC-binding Protein EB1, End-binding Protein 1, EB1, MGC117374, MGC129946) (Biotin)

Gene Names
MAPRE1; EB1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAPRE1; Monoclonal Antibody; MAPRE1 (Microtubule-associated Protein RP/EB Family Member 1; APC-binding Protein EB1; End-binding Protein 1; EB1; MGC117374; MGC129946) (Biotin); anti-MAPRE1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F3
Specificity
Recognizes human MAPRE1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-MAPRE1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-110 from human MAPRE1 (NM_012325, NP_036457) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQW
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for 129421 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for 129421 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-MAPRE1 antibody
MAPRE1 was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability.
Product Categories/Family for anti-MAPRE1 antibody
References
1. Proteomic analysis of the effects of the immunomodulatory mycotoxin deoxynivalenol. da Costa AN, Mijal RS, Keen JN, Findlay JB, Wild CP.Proteomics. 2011 Mar 9. doi: 10.1002/pmic.201000580.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.2 kDa (288aa) confirmed by MALDI-TOF
NCBI Official Full Name
microtubule-associated protein RP/EB family member 1
NCBI Official Synonym Full Names
microtubule associated protein RP/EB family member 1
NCBI Official Symbol
MAPRE1
NCBI Official Synonym Symbols
EB1
NCBI Protein Information
microtubule-associated protein RP/EB family member 1
UniProt Protein Name
Microtubule-associated protein RP/EB family member 1
UniProt Gene Name
MAPRE1
UniProt Synonym Gene Names
EB1
UniProt Entry Name
MARE1_HUMAN

NCBI Description

The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family. [provided by RefSeq, Jul 2008]

Uniprot Description

EB1: a microtubule-associated protein of the RP/EB family. Binds to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. Localizes to microtubules, especially the growing ends, in interphase cells. Associates with the centrosomes and spindle microtubules during mitosis. Also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. May be involved in the regulation of microtubule structures and chromosome stability.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 20q11.1-q11.23

Cellular Component: Golgi apparatus; centrosome; microtubule; cell projection membrane; cytoplasmic microtubule; cytoplasm; cortical microtubule cytoskeleton; spindle; cytosol

Molecular Function: protein C-terminus binding; microtubule plus-end binding; protein binding

Biological Process: mitosis; cell proliferation; cell division; organelle organization and biogenesis; negative regulation of microtubule polymerization; mitotic cell cycle; G2/M transition of mitotic cell cycle

Research Articles on MAPRE1

Similar Products

Product Notes

The MAPRE1 mapre1 (Catalog #AAA6142825) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MAPRE1 (Microtubule-associated Protein RP/EB Family Member 1, APC-binding Protein EB1, End-binding Protein 1, EB1, MGC117374, MGC129946) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPRE1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAPRE1 mapre1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAPRE1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.