Mouse MAGI2 Monoclonal Antibody | anti-MAGI2 antibody

MAGI2 (Membrane Associated Guanylate Kinase, WW and PDZ Domain Containing 2, ACVRIP1, AIP1, ARIP1, MAGI-2, SSCAM) (Biotin)

Cat. Num. AAA6173820

• Gene Names: MAGI2; AIP1; AIP-1; ARIP1; SSCAM; MAGI-2; ACVRIP1
• Applications: Western Blot
• Purity: Purified
• Synonyms: MAGI2; Monoclonal Antibody; MAGI2 (Membrane Associated Guanylate Kinase; WW and PDZ Domain Containing 2; ACVRIP1; AIP1; ARIP1; MAGI-2; SSCAM) (Biotin); Membrane Associated Guanylate Kinase; SSCAM; anti-MAGI2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6F5
• Specificity: Recognizes MAGI2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-MAGI2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: MAGI2 (NP_036433, 519aa-628aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PANSMVPPLAIMERPPPVMVNGRHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQAELMTLTIVKGAQGFGFTIADSPTGQRV
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MAGI2 is 0.03 ng/ml as a capture antibody.)

Related Product Information for anti-MAGI2 antibody

The protein encoded by this gene interacts with atrophin-1. Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. This encoded protein is characterized by two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. [provided by RefSeq]

Product Categories/Family for anti-MAGI2 antibody

Antibodies; PDZ Domain

NCBI and Uniprot Product Information

• NCBI GI #: 27436957
• NCBI GeneID: 9863
• NCBI Accession #: NP_036433
• NCBI GenBank Nucleotide #: NM_012301
• UniProt Accession #: Q86UL8; O60434; O60510; Q86UI7; Q9NP44; Q9UDQ5; Q9UDU1; A4D1C1; A7E2C3
• Molecular Weight: 157,236 Da
• NCBI Official Full Name: membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 isoform 1
• NCBI Official Synonym Full Names: membrane associated guanylate kinase, WW and PDZ domain containing 2
• NCBI Official Symbol: MAGI2
• NCBI Official Synonym Symbols: AIP1; AIP-1; ARIP1; SSCAM; MAGI-2; ACVRIP1
• NCBI Protein Information: membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2; activin receptor interacting protein 1; atrophin-1-interacting protein 1; atrophin-1-interacting protein A; membrane-associated guanylate kinase inverted 2
• UniProt Protein Name: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
• Protein Family: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein
• UniProt Gene Name: MAGI2
• UniProt Synonym Gene Names: ACVRINP1; AIP1; KIAA0705; AIP-1; MAGI-2
• UniProt Entry Name: MAGI2_HUMAN

Uniprot Description

AIP1: a scaffold molecule at synaptic junctions that apparently couples neurotransmitter receptors and cell adhesion proteins. Contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. Contains two WW domains, a guanylate kinase-like domain, and multiple PDZ domains. It has structural similarity to the membrane-associated guanylate kinase homologue (MAGUK) family. This protein is brain specific, where it appears to be widely expressed in both neurons and glia. Enhances the ability of PTEN to suppress AKT1 activation. Two splice-variant isoforms have been described.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 7q21

Cellular Component: protein complex; tight junction; perinuclear region of cytoplasm; cytoplasm; postsynaptic density; dendrite; late endosome; plasma membrane; synapse; nucleus

Molecular Function: signal transducer activity; protein binding; receptor signaling complex scaffold activity; beta-1 adrenergic receptor binding; SMAD binding; phosphatase binding

Biological Process: positive regulation of phosphoprotein phosphatase activity; negative regulation of activin receptor signaling pathway; negative regulation of cell proliferation; negative regulation of protein kinase B signaling cascade; protein heterooligomerization; positive regulation of receptor internalization; negative regulation of cell migration; receptor clustering; cytoplasmic transport