Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cells, using CYP7B1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5min.)

Rabbit CYP7B1 Polyclonal Antibody | anti-CYP7B1 antibody

CYP7B1 Rabbit pAb

Gene Names
CYP7B1; CP7B; CBAS3; SPG5A
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
CYP7B1; Polyclonal Antibody; CYP7B1 Rabbit pAb; CBAS3; CP7B; SPG5A; anti-CYP7B1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, pH7.3.
Sequence
VIVCDNNKFISELRDDFLKFDDKFAYLVSNIPIELLGNVKSIREKIIKCFSSEKLAKMQGWSEVFQSRQDVLEKYYVHEDLEIGAHHLGFLWASVANTIPT
Applicable Applications for anti-CYP7B1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:1000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CYP7B1 (NP_004811.1).
Cellular Location
Endoplasmic reticulum membrane, Microsome membrane, Peripheral membrane protein
Positive Samples
mouse kidney, rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cells, using CYP7B1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5min.)

Western Blot (WB) (Western blot analysis of extracts of various cells, using CYP7B1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5min.)
Related Product Information for anti-CYP7B1 antibody
Background: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,256 Da
NCBI Official Full Name
25-hydroxycholesterol 7-alpha-hydroxylase
NCBI Official Synonym Full Names
cytochrome P450, family 7, subfamily B, polypeptide 1
NCBI Official Symbol
CYP7B1
NCBI Official Synonym Symbols
CP7B; CBAS3; SPG5A
NCBI Protein Information
25-hydroxycholesterol 7-alpha-hydroxylase; cytochrome P450 7B1; oxysterol 7alpha-hydroxylase; oxysterol 7-alpha-hydroxylase; cytochrome P450, subfamily VIIB (oxysterol 7 alpha-hydroxylase), polypeptide 1
UniProt Protein Name
25-hydroxycholesterol 7-alpha-hydroxylase
UniProt Gene Name
CYP7B1
UniProt Entry Name
CP7B1_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway of extrahepatic tissues, which converts cholesterol to bile acids. This enzyme likely plays a minor role in total bile acid synthesis, but may also be involved in the development of atherosclerosis, neurosteroid metabolism and sex hormone synthesis. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP7B1: Defects in CYP7B1 are the cause of spastic paraplegia autosomal recessive type 5A (SPG5A). Spastic paraplegia is a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body. Defects in CYP7B1 are the cause of congenital bile acid synthesis defect type 3 (CBAS3). Clinical features include severe cholestasis, cirrhosis and liver synthetic failure. Hepatic microsomal oxysterol 7-alpha-hydroxylase activity is undetectable. Belongs to the cytochrome P450 family.

Protein type: Oxidoreductase; EC 1.14.13.100; Endoplasmic reticulum; Lipid Metabolism - primary bile acid biosynthesis

Chromosomal Location of Human Ortholog: 8q21.3

Cellular Component: endoplasmic reticulum membrane

Molecular Function: 25-hydroxycholesterol 7alpha-hydroxylase activity; iron ion binding; heme binding; oxysterol 7-alpha-hydroxylase activity

Biological Process: cholesterol metabolic process; bile acid biosynthetic process; bile acid metabolic process; xenobiotic metabolic process; sterol metabolic process; transmembrane transport; positive regulation of epithelial cell proliferation; negative regulation of estrogen receptor signaling pathway

Disease: Spastic Paraplegia 5a, Autosomal Recessive; Bile Acid Synthesis Defect, Congenital, 3

Research Articles on CYP7B1

Similar Products

Product Notes

The CYP7B1 cyp7b1 (Catalog #AAA9143081) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP7B1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CYP7B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:1000. Researchers should empirically determine the suitability of the CYP7B1 cyp7b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VIVCDNNKFI SELRDDFLKF DDKFAYLVSN IPIELLGNVK SIREKIIKCF SSEKLAKMQG WSEVFQSRQD VLEKYYVHED LEIGAHHLGF LWASVANTIP T. It is sometimes possible for the material contained within the vial of "CYP7B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.