Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Lymphocyte Antigen 75 Monoclonal Antibody | anti-LY75 antibody

Lymphocyte Antigen 75 (LY75, Ly-75, C-type Lectin Domain Family 13 Member B, DEC-205, gp200-MR6, CD205, CLEC13B) (MaxLight 750)

Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Lymphocyte Antigen 75; Monoclonal Antibody; Lymphocyte Antigen 75 (LY75; Ly-75; C-type Lectin Domain Family 13 Member B; DEC-205; gp200-MR6; CD205; CLEC13B) (MaxLight 750); anti-LY75 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G4
Specificity
Recognizes human LY75.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
1722
Applicable Applications for anti-LY75 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa37-135 from human LY75 (NP_002340) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TIVHGNTGKCIKPVYGWIVADDCDETEDKLWKWVSQHRLFHLHSQKCLGLDITKSVNELRMFSCDSSAMLWWKCEHHSLYGAARYRLALKDGHGTAIS
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-LY75 antibody
CD205 is a 210kD C-type lectin transmembrane protein, known as DEC-205. It belongs to macrophage mannose receptor family and is found at high levels on dendritic cells and thymic epithelial cells. Unlike murine CD205, human CD205 is also expressed at low levels on T- and B-cells, NK cells and monocytes. CD205, serves as an endocytic receptor, functions in antigen uptake/processing and clearance of apoptotic cells.
Product Categories/Family for anti-LY75 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
lymphocyte antigen 75
UniProt Protein Name
Lymphocyte antigen 75
Protein Family
UniProt Gene Name
LY75
UniProt Synonym Gene Names
CD205; CLEC13B; Ly-75
UniProt Entry Name
LY75_HUMAN

Uniprot Description

LY75: Acts as an endocytic receptor to direct captured antigens from the extracellular space to a specialized antigen- processing compartment. Causes reduced proliferation of B-lymphocytes. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q24

Cellular Component: integral to plasma membrane

Molecular Function: receptor activity; carbohydrate binding

Biological Process: endocytosis; immune response; inflammatory response

Similar Products

Product Notes

The LY75 ly75 (Catalog #AAA6233727) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Lymphocyte Antigen 75 (LY75, Ly-75, C-type Lectin Domain Family 13 Member B, DEC-205, gp200-MR6, CD205, CLEC13B) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Lymphocyte Antigen 75 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LY75 ly75 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Lymphocyte Antigen 75, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.