Western Blot (WB)
(LXN monoclonal antibody (M01), clone 8H5. Western Blot analysis of LXN expression in MCF-7.)
Mouse LXN Monoclonal Antibody | anti-LXN antibody
LXN (Latexin, ECI, TCI) (Biotin)
Gene Names
LXN; ECI; TCI
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
LXN; Monoclonal Antibody; LXN (Latexin; ECI; TCI) (Biotin); Latexin; TCI; anti-LXN antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8H5
Specificity
Recognizes LXN.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-LXN antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
LXN (NP_064554.2, 151aa-222aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(LXN monoclonal antibody (M01), clone 8H5. Western Blot analysis of LXN expression in MCF-7.)
Western Blot (WB)
(LXN monoclonal antibody (M01), clone 8H5. Western Blot analysis of LXN expression in MCF-7.)
Western Blot (WB)
(Western Blot analysis of LXN expression in transfected 293T cell line by LXN monoclonal antibody (M01), clone 8H5.Lane 1: LXN transfected lysate (Predicted MW: 25.8 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of LXN expression in transfected 293T cell line by LXN monoclonal antibody (M01), clone 8H5.Lane 1: LXN transfected lysate (Predicted MW: 25.8 KDa).Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged LXN is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged LXN is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-LXN antibody
This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. [provided by RefSeq]
Product Categories/Family for anti-LXN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,750 Da
NCBI Official Full Name
latexin
NCBI Official Synonym Full Names
latexin
NCBI Official Symbol
LXN
NCBI Official Synonym Symbols
ECI; TCI
NCBI Protein Information
latexin
Protein Family
NCBI Description
This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. [provided by RefSeq, Oct 2008]
Research Articles on LXN
Similar Products
Product Notes
The LXN (Catalog #AAA6174488) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LXN can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LXN for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LXN, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
