Mouse LRRC8A Monoclonal Antibody | anti-LRRC8A antibody

LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A, FLJ10337, FLJ41617, KIAA1437, LRRC8) (AP)

Cat. Num. AAA6165725

• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: LRRC8A; Monoclonal Antibody; LRRC8A (Leucine Rich Repeat Containing 8 Family; Member A; FLJ10337; FLJ41617; KIAA1437; LRRC8) (AP); Leucine Rich Repeat Containing 8 Family; LRRC8; anti-LRRC8A antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8H9
• Specificity: Recognizes LRRC8A.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 810

• Applicable Applications for anti-LRRC8A antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: LRRC8A (NP_062540.2, 711aa-810aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(LRRC8A monoclonal antibody (M04), clone 8H9. Western Blot analysis of LRRC8A expression in A-431.)

Related Product Information for anti-LRRC8A antibody

This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq]

Product Categories/Family for anti-LRRC8A antibody

Antibodies; Leucine-rich Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 62241040
• NCBI Accession #: NP_062540.2
• NCBI GenBank Nucleotide #: NP_062540.2
• UniProt Accession #: Q8IWT6
• NCBI Official Full Name: volume-regulated anion channel subunit LRRC8A
• UniProt Protein Name: Volume-regulated anion channel subunit LRRC8A
• Protein Family: Volume-regulated anion channel
• UniProt Gene Name: LRRC8A
• UniProt Synonym Gene Names: KIAA1437; LRRC8; SWELL1
• UniProt Entry Name: LRC8A_HUMAN

Uniprot Description

LRRC8A: Involved in B-cell development. Required for the pro-B cell to pre-B cell transition. Defects in LRRC8A are the cause of agammaglobulinemia type 5 (AGM5). It is a primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B-cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life. A chromosomal aberration involving LRRC8 has been found in a patient with congenital agammaglobulinemia. Translocation t(9;20)(q33.2;q12). The translocation truncates the LRRC8 gene, resulting in deletion of the eighth, ninth, and half of the seventh LRR domains.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 9q34.11

Cellular Component: cell surface; membrane; plasma membrane

Molecular Function: anion channel activity; protein binding; volume-sensitive anion channel activity

Biological Process: anion transport; cell volume homeostasis; pre-B cell differentiation; response to osmotic stress

Disease: Agammaglobulinemia 5, Autosomal Dominant