Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human LRRC4C Monoclonal Antibody | anti-LRRC4C antibody

LRRC4C (KIAA1580, NGL1, Leucine-rich Repeat-containing Protein 4C, Netrin-G1 Ligand)) (PE)

Gene Names
LRRC4C; NGL1; NGL-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LRRC4C; Monoclonal Antibody; LRRC4C (KIAA1580; NGL1; Leucine-rich Repeat-containing Protein 4C; Netrin-G1 Ligand)) (PE); anti-LRRC4C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G5
Specificity
Recognizes human LRRC4C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
640
Applicable Applications for anti-LRRC4C antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa541-641 from human LRRC4C (NP_065980) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AVMLVIFYKMRKQHHRQNHHAPTRTVEIINVDDEITGDTPMESHLPMPAIEHEHLNHYNSYKSPFNHTTTVNTINSIHSSVHEPLLIRMNSKDNVQETQI
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of LRRC4C expression in transfected 293T cell line by LRRC4C monoclonal antibody. Lane 1: LRRC4C transfected lysate (71.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LRRC4C expression in transfected 293T cell line by LRRC4C monoclonal antibody. Lane 1: LRRC4C transfected lysate (71.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged LRRC4C is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LRRC4C is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-LRRC4C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
leucine-rich repeat-containing protein 4C
NCBI Official Synonym Full Names
leucine rich repeat containing 4C
NCBI Official Symbol
LRRC4C
NCBI Official Synonym Symbols
NGL1; NGL-1
NCBI Protein Information
leucine-rich repeat-containing protein 4C
UniProt Protein Name
Leucine-rich repeat-containing protein 4C
UniProt Gene Name
LRRC4C
UniProt Synonym Gene Names
KIAA1580; NGL1; NGL-1
UniProt Entry Name
LRC4C_HUMAN

NCBI Description

NGL1 is a specific binding partner for netrin G1 (NTNG1; MIM 608818), which is a member of the netrin family of axon guidance molecules (Lin et al., 2003 [PubMed 14595443]).[supplied by OMIM, Mar 2008]

Uniprot Description

LRRC4C: May promote neurite outgrowth of developing thalamic neurons.

Protein type: Membrane protein, integral; Cell development/differentiation

Chromosomal Location of Human Ortholog: 11p12

Cellular Component: postsynaptic membrane; extracellular space; membrane; integral to membrane; cell junction

Molecular Function: protein binding

Biological Process: regulation of axonogenesis

Research Articles on LRRC4C

Similar Products

Product Notes

The LRRC4C lrrc4c (Catalog #AAA6158662) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LRRC4C (KIAA1580, NGL1, Leucine-rich Repeat-containing Protein 4C, Netrin-G1 Ligand)) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LRRC4C can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LRRC4C lrrc4c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LRRC4C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.