Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human LRRC29 Monoclonal Antibody

LRRC29 (FBL9, FBXL9, Leucine-rich Repeat-containing Protein 29, F-box and Leucine-rich Repeat Protein 9, F-box Protein FBL9, F-box/LRR-repeat Protein 9)

Reactivity
Human
Applications
ELISA
Purity
Ascites
Ascites
Synonyms
LRRC29; Monoclonal Antibody; LRRC29 (FBL9; FBXL9; Leucine-rich Repeat-containing Protein 29; F-box and Leucine-rich Repeat Protein 9; F-box Protein FBL9; F-box/LRR-repeat Protein 9); Anti -LRRC29 (FBL9; anti-LRRC29 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
4H7
Specificity
Recognizes human LRRC29.
Purity/Purification
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
CPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL*
Applicable Applications for anti-LRRC29 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa125-224 from human LRRC29 (NP_03629) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-LRRC29 antibody
This gene encodes a member of the F-box protein family which is characterized by an approximately 40aa motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 9 tandem leucine-rich repeats. Two transcript variants encoding the same protein have been found for this gene. Other variants may occur, but their full-length natures have not been characterized.
Product Categories/Family for anti-LRRC29 antibody

Similar Products

Product Notes

The LRRC29 (Catalog #AAA641460) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LRRC29 (FBL9, FBXL9, Leucine-rich Repeat-containing Protein 29, F-box and Leucine-rich Repeat Protein 9, F-box Protein FBL9, F-box/LRR-repeat Protein 9) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LRRC29 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the LRRC29 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CPSLEHLALS HCSRLSDKGW AQAASSWPRL QHLNLSSCSQ LIEQTLDAIG QACRQLRVLD VATCPGINMA AVRRFQAQLP QVSCVQSRFV GGADLTLTL*. It is sometimes possible for the material contained within the vial of "LRRC29, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.