Mouse anti-Human FBXO9 Monoclonal Antibody | anti-FBXO9 antibody

FBXO9 (FBX9, VCIA1, F-box Only Protein 9, Cross-immune Reaction Antigen 1, Renal Carcinoma Antigen NY-REN-57, dJ341E18.2, DKFZp434C0118, KIAA0936)

Cat. Num. AAA6000179

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: FBXO9; Monoclonal Antibody; FBXO9 (FBX9; VCIA1; F-box Only Protein 9; Cross-immune Reaction Antigen 1; Renal Carcinoma Antigen NY-REN-57; dJ341E18.2; DKFZp434C0118; KIAA0936); Anti -FBXO9 (FBX9; anti-FBXO9 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1G12
• Specificity: Recognizes human FBXO9.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: HYRLSQDTDNQTKVFAVITKKKEEKPLDYKYRYFRRVPVQEADQSFHVGLQLCSSGHQRFNKLIWIHHSCHITYKSTGETAVSAFEIDKMYTPLFFARVRSYTAFSERPL*

• Applicable Applications for anti-FBXO9 antibody: ELISA (EL/EIA), Immunohistochemistry (IHC)
• Application Notes: Suitable for use in ELISA and Immunohistochemistry.; Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa338-448 from human FBXO9 (NP_036479) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FBXO9 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged FBXO9 is 1ng/ml as a capture antibody.)

Related Product Information for anti-FBXO9 antibody

This gene encodes a member of the F-box protein family which is characterized by an approximately 40aa motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates at least 3 transcript variants diverging at the 5' terminus.

Product Categories/Family for anti-FBXO9 antibody

Antibodies; Abs to Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 77735771
• NCBI GeneID: 511798
• NCBI Accession #: NP_001029584.1
• NCBI GenBank Nucleotide #: NM_001034412.2
• UniProt Accession #: Q3ZBT2; F1MVQ0
• Molecular Weight: 50,817 Da
• NCBI Official Full Name: F-box only protein 9
• NCBI Official Symbol: FBXO9
• NCBI Protein Information: F-box only protein 9
• UniProt Protein Name: F-box only protein 9
• Protein Family: F-box only protein
• UniProt Gene Name: FBXO9
• UniProt Entry Name: FBX9_BOVIN

Uniprot Description

Function: Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of TTI1 and TELO2 in a CK2-dependent manner, thereby directly regulating mTOR signaling. SCF(FBXO9) recognizes and binds mTORC1-bound TTI1 and TELO2 when they are phosphorylated by CK2 following growth factor deprivation, leading to their degradation. In contrast, the SCF(FBXO9) does not mediate ubiquitination of TTI1 and TELO2 when they are part of the mTORC2 complex. As a consequence, mTORC1 is inactivated to restrain cell growth and protein translation, while mTORC2 is activated due to the relief of feedback inhibition by mTORC1

By similarity.

Pathway: Protein modification; protein ubiquitination.

Subunit structure: Part of the SCF (SKP1-CUL1-F-box) E3 ubiquitin-protein ligase complex SCF(FBXO9) composed of CUL1, SKP1, RBX1 and FBXO9. Interacts with TTI1 and TELO2; when TTI1 and TELO2 are phosphorylated by CK2

By similarity.

Subcellular location: Cytoplasm

By similarity.

Sequence similarities: Contains 1 F-box domain.Contains 1 TPR repeat.