Mouse anti-Human LMO7 Monoclonal Antibody | anti-LMO7 antibody

LMO7 (LIM Domain Only Protein 7, LMO-7, F-box Only Protein 20, LOMP, FBX20, FBXO20, KIAA0858) APC

Cat. Num. AAA6137424

• Gene Names: LMO7; LOMP; FBX20; LMO7b; FBXO20
• Reactivity: Human
• Applications: ELISA, Immunofluorescence
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LMO7; Monoclonal Antibody; LMO7 (LIM Domain Only Protein 7; LMO-7; F-box Only Protein 20; LOMP; FBX20; FBXO20; KIAA0858) APC; anti-LMO7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4B4
• Specificity: Recognizes human LMO7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 1349

• Applicable Applications for anti-LMO7 antibody: ELISA (EIA), Immunofluorescence (IF)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa453-540 from human LMO7 (NP_005349) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATYPSEIPKEDSTTFAKREDRVTTEIQLPSQSPVEEQSP
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LMO7 on HeLa cell. [antibody concentration 10ug/ml])

Product Categories/Family for anti-LMO7 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 33598968
• NCBI GeneID: 4008
• NCBI Accession #: NP_005349
• NCBI GenBank Nucleotide #: NM_005358
• UniProt Accession #: Q8WWI1
• NCBI Official Full Name: LIM domain only protein 7 isoform 1
• NCBI Official Synonym Full Names: LIM domain 7
• NCBI Official Symbol: LMO7
• NCBI Official Synonym Symbols: LOMP; FBX20; LMO7b; FBXO20
• NCBI Protein Information: LIM domain only protein 7
• UniProt Protein Name: LIM domain only protein 7
• Protein Family: LIM domain only protein
• UniProt Gene Name: LMO7
• UniProt Synonym Gene Names: FBX20; FBXO20; KIAA0858; LMO-7
• UniProt Entry Name: LMO7_HUMAN

NCBI Description

This gene encodes a protein containing a calponin homology (CH) domain, a PDZ domain, and a LIM domain, and may be involved in protein-protein interactions. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene, however, the full-length nature of some variants is not known. [provided by RefSeq, Jan 2009]

Uniprot Description

LMO7: contains a calponin homology (CH) domain, a PDZ domain, and a LIM domain; an F-box (FBX) domain is present in alternative splice variants. This protein is known to be upregulated in seven types of cancer. Translocates from the cell surface to the cytoplasm to the nucleus, regulates transcription of many genes, and may transmit mechanical signals from focal adhesions. Members of the LIM protein family carry the LIM domain, a unique cysteine-rich zinc-binding domain. Members of the FBX protein family are involved in protein-protein interactions. Four alternatively spliced isoforms have been described.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 13q22.2

Cellular Component: focal adhesion; cytoplasm; nucleus; ubiquitin ligase complex

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity

Biological Process: regulation of cell adhesion; protein ubiquitination