Western Blot (WB)
(Western Blot detection against Immunogen (43.12kD).)
Mouse anti-Human LMO2 Monoclonal Antibody | anti-LMO2 antibody
LMO2 (Rhombotin-2, Cysteine-rich Protein TTG-2, LIM Domain Only Protein 2, LMO-2, T-cell Translocation Protein 2, RBTN2, RBTNL1, RHOM2, TTG2) (Biotin)
Gene Names
LMO2; TTG2; RBTN2; RHOM2; RBTNL1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LMO2; Monoclonal Antibody; LMO2 (Rhombotin-2; Cysteine-rich Protein TTG-2; LIM Domain Only Protein 2; LMO-2; T-cell Translocation Protein 2; RBTN2; RBTNL1; RHOM2; TTG2) (Biotin); anti-LMO2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B3
Specificity
Recognizes human LMO2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-LMO2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-158 from human LMO2 (AAH34041) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (43.12kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (43.12kD).)
Western Blot (WB)
(LMO2 monoclonal antibody. Western Blot analysis of LMO2 expression in human spleen.)
Western Blot (WB)
(LMO2 monoclonal antibody. Western Blot analysis of LMO2 expression in human spleen.)
Western Blot (WB)
(LMO2 monoclonal antibody Western Blot analysis of LMO2 expression in HL-60.)
Western Blot (WB)
(LMO2 monoclonal antibody Western Blot analysis of LMO2 expression in HL-60.)
Related Product Information for anti-LMO2 antibody
Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state.
Product Categories/Family for anti-LMO2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
5,941 Da
NCBI Official Full Name
Homo sapiens LIM domain only 2 (rhombotin-like 1), mRNA
NCBI Official Synonym Full Names
LIM domain only 2
NCBI Official Symbol
LMO2
NCBI Official Synonym Symbols
TTG2; RBTN2; RHOM2; RBTNL1
NCBI Protein Information
rhombotin-2
Protein Family
NCBI Description
LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2008]
Research Articles on LMO2
Similar Products
Product Notes
The LMO2 (Catalog #AAA6142724) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LMO2 (Rhombotin-2, Cysteine-rich Protein TTG-2, LIM Domain Only Protein 2, LMO-2, T-cell Translocation Protein 2, RBTN2, RBTNL1, RHOM2, TTG2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LMO2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LMO2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LMO2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
