Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human LLGL2 Monoclonal Antibody | anti-LLGL2 antibody

LLGL2 (Lethal(2) Giant Larvae Protein Homolog 2, HGL) APC

Gene Names
LLGL2; HGL; LGL2; Hugl-2
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LLGL2; Monoclonal Antibody; LLGL2 (Lethal(2) Giant Larvae Protein Homolog 2; HGL) APC; anti-LLGL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G2
Specificity
Recognizes human LLGL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1015
Applicable Applications for anti-LLGL2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa101-199 from human LLGL2 (NP_004515) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of LLGL2 expression in transfected 293T cell line by LLGL2 monoclonal antibody. Lane 1: LLGL2 transfected lysate (113kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LLGL2 expression in transfected 293T cell line by LLGL2 monoclonal antibody. Lane 1: LLGL2 transfected lysate (113kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LLGL2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to LLGL2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1ug/ml])

Testing Data

(Detection limit for recombinant GST tagged LLGL2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LLGL2 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-LLGL2 antibody
References
1. Loss of Scribble causes cell competition in mammalian cells. Norman M, Wisniewska KA, Lawrenson K, Garcia-Miranda P, Tada M, Kajita M, Mano H, Ishikawa S, Ikegawa M, Shimada T, Fujita Y.J Cell Sci. 2012 Jan 1;125(Pt 1):59-66. Epub 2012 Jan 16. 2. Involvement of Lgl and Mahjong/VprBP in cell competition. Tamori Y, Bialucha CU, Tian AG, Kajita M, Huang YC, Norman M, Harrison N, Poulton J, Ivanovitch K, Disch L, Liu T, Deng WM, Fujita Y.PLoS Biol. 2010 Jul 13;8(7):e1000422. 3. ASPP2 Regulates Epithelial Cell Polarity through the PAR Complex. Cong W, Hirose T, Harita Y, Yamashita A, Mizuno K, Hirano H, Ohno S.Curr Biol. 2010 Jul 7.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
LLGL scribble cell polarity complex component 2 isoform a
NCBI Official Synonym Full Names
LLGL scribble cell polarity complex component 2
NCBI Official Symbol
LLGL2
NCBI Official Synonym Symbols
HGL; LGL2; Hugl-2
NCBI Protein Information
LLGL scribble cell polarity complex component 2
UniProt Protein Name
Lethal(2) giant larvae protein homolog 2
UniProt Gene Name
LLGL2
UniProt Entry Name
L2GL2_HUMAN

NCBI Description

The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the protein's ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC). In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Research Articles on LLGL2

Similar Products

Product Notes

The LLGL2 llgl2 (Catalog #AAA6137417) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LLGL2 (Lethal(2) Giant Larvae Protein Homolog 2, HGL) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LLGL2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LLGL2 llgl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LLGL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.