Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human LLGL1 Monoclonal Antibody | anti-LLGL1 antibody

LLGL1 (Lethal(2) Giant Larvae Protein Homolog 1, LLGL, Human Homolog To The D-lgl Gene Protein, Hugl-1, DLG4, DLG4, HUGL, HUGL1)

Gene Names
LLGL1; DLG4; HUGL; LLGL; HUGL1; HUGL-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
LLGL1; Monoclonal Antibody; LLGL1 (Lethal(2) Giant Larvae Protein Homolog 1; LLGL; Human Homolog To The D-lgl Gene Protein; Hugl-1; DLG4; HUGL; HUGL1); Anti -LLGL1 (Lethal(2) Giant Larvae Protein Homolog 1; anti-LLGL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5G2
Specificity
Recognizes human LLGL1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSP
Applicable Applications for anti-LLGL1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa911-1010 from human LLGL1 (NP_004131) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged LLGL1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LLGL1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-LLGL1 antibody
Cortical cytoskeleton protein found in a complex involved in maintaining cell polarity and epithelial integrity. Involved in the regulation of mitotic spindle orientation, proliferation, differentiation and tissue organization of neuroepithelial cells. Involved in axonogenesis through RAB10 activation thereby regulating vesicular membrane trafficking toward the axonal plasma membrane.
Product Categories/Family for anti-LLGL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
115,418 Da
NCBI Official Full Name
lethal(2) giant larvae protein homolog 1
NCBI Official Synonym Full Names
lethal giant larvae homolog 1 (Drosophila)
NCBI Official Symbol
LLGL1
NCBI Official Synonym Symbols
DLG4; HUGL; LLGL; HUGL1; HUGL-1
NCBI Protein Information
lethal(2) giant larvae protein homolog 1; lethal(2) giant larvae protein homolog 1; human homolog to the D-lgl gene protein
UniProt Protein Name
Lethal(2) giant larvae protein homolog 1
UniProt Gene Name
LLGL1
UniProt Synonym Gene Names
DLG4; HUGL; HUGL1; LLGL
UniProt Entry Name
L2GL1_HUMAN

NCBI Description

This gene encodes a protein that is similar to a tumor suppressor in Drosophila. The protein is part of a cytoskeletal network and is associated with nonmuscle myosin II heavy chain and a kinase that specifically phosphorylates this protein at serine residues. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]

Uniprot Description

LLGL1: Cortical cytoskeleton protein found in a complex involved in maintaining cell polarity and epithelial integrity. Involved in the regulation of mitotic spindle orientation, proliferation, differentiation and tissue organization of neuroepithelial cells. Belongs to the WD repeat L(2)GL family.

Protein type: Cytoskeletal; Cell adhesion; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17p11.2

Cellular Component: Golgi membrane; cortical actin cytoskeleton; cytoskeleton; early endosome membrane; axon; cytoplasm; Golgi cis cisterna; trans-Golgi network membrane

Molecular Function: protein binding; structural molecule activity; protein kinase binding

Biological Process: Golgi to plasma membrane transport; exocytosis; axonogenesis; protein complex assembly; cortical actin cytoskeleton organization and biogenesis; maintenance of apical/basal cell polarity

Research Articles on LLGL1

Similar Products

Product Notes

The LLGL1 llgl1 (Catalog #AAA6003877) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LLGL1 (Lethal(2) Giant Larvae Protein Homolog 1, LLGL, Human Homolog To The D-lgl Gene Protein, Hugl-1, DLG4, DLG4, HUGL, HUGL1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LLGL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the LLGL1 llgl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GIASCVFTRH GQGFYLISPS EFERFSLSAR NITEPLCSLD INWPRDATQA SYRIRESPKL SQANGTPSIL LAPQSLDGSP DPAHSMGPDT PEPPEAALSP. It is sometimes possible for the material contained within the vial of "LLGL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.