Mouse anti-Human LIVIN Monoclonal Antibody | anti-LIVIN antibody

LIVIN (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor of Apoptosis Protein, KIAP, ML-IAP, RING Finger Protein 50, Melanoma Inhibitor of Apoptosis Protein, BIRC7, KIAP, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344) APC

Cat. Num. AAA6137415

• Gene Names: BIRC7; KIAP; LIVIN; MLIAP; RNF50; ML-IAP
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LIVIN; Monoclonal Antibody; LIVIN (Baculoviral IAP Repeat-containing Protein 7; Kidney Inhibitor of Apoptosis Protein; KIAP; ML-IAP; RING Finger Protein 50; Melanoma Inhibitor of Apoptosis Protein; BIRC7; MLIAP; RNF50; UNQ5800/PRO19607/PRO21344) APC; anti-LIVIN antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H1
• Specificity: Recognizes human BIRC7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-LIVIN antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-91 from human BIRC7 (NP_647478) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELR
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged BIRC7 is 1ng/ml as a capture antibody.)

Related Product Information for anti-LIVIN antibody

Livin is a member of IAP family characterized by the presence of an N-terminal, conserved, single BIR domain and a C-terminal RING-type zinc finger domain. It plays a vital role in caspase regulation, anti-apoptosis and tumorigenesis. Livin interacts with diverse pro-apoptotic factors and inhibits apoptosis triggered by various death stimuli in a caspase-dependent and caspase-independent methods. BIR domain of Livin binds to caspase-9, inhibits its proteolysis and induces a caspase-dependent anti-apoptotic cascade. Alternatively, Livin has also been found to activate MAP kinase and inhibit apoptosis via TAK1/JNK1 signaling cascade. Northern Blot analysis detected an elevated expression in developmental tissues and human melanomas, suggesting a potential cancer target.

Product Categories/Family for anti-LIVIN antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 21536421
• NCBI GeneID: 79444
• NCBI Accession #: NP_647478.1; NP_071444.1
• NCBI GenBank Nucleotide #: NM_139317
• Molecular Weight: 30,866 Da
• NCBI Official Full Name: baculoviral IAP repeat-containing protein 7 isoform alpha
• NCBI Official Synonym Full Names: baculoviral IAP repeat containing 7
• NCBI Official Symbol: BIRC7
• NCBI Official Synonym Symbols: KIAP; LIVIN; MLIAP; RNF50; ML-IAP
• NCBI Protein Information: baculoviral IAP repeat-containing protein 7

NCBI Description

This gene encodes a member of the inhibitor of apoptosis protein (IAP) family, and contains a single copy of a baculovirus IAP repeat (BIR) as well as a RING-type zinc finger domain. The BIR domain is essential for inhibitory activity and interacts with caspases, while the RING finger domain sometimes enhances antiapoptotic activity but does not inhibit apoptosis alone. Elevated levels of the encoded protein may be associated with cancer progression and play a role in chemotherapy sensitivity. Alternative splicing results in multiple transcript variants [provided by RefSeq, Jul 2013]