Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (LIMK1 monoclonal antibody (M05), clone 2E9 Western Blot analysis of LIMK1 expression in HeLa.)

Mouse anti-Human LIMK1 Monoclonal Antibody | anti-LIMK1 antibody

LIMK1 (LIM Domain Kinase 1, LIMK) (AP)

Gene Names
LIMK1; LIMK; LIMK-1
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
LIMK1; Monoclonal Antibody; LIMK1 (LIM Domain Kinase 1; LIMK) (AP); LIM Domain Kinase 1; LIMK; anti-LIMK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E9
Specificity
Recognizes human LIMK1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-LIMK1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
LIMK1 (NP_002305, 548aa-647aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(LIMK1 monoclonal antibody (M05), clone 2E9 Western Blot analysis of LIMK1 expression in HeLa.)

Western Blot (WB) (LIMK1 monoclonal antibody (M05), clone 2E9 Western Blot analysis of LIMK1 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged LIMK1 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LIMK1 is approximately 0.3ng/ml as a capture antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LIMK1 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to LIMK1 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LIMK1 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to LIMK1 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml])
Related Product Information for anti-LIMK1 antibody
There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome. [provided by RefSeq]
Product Categories/Family for anti-LIMK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
68,729 Da
NCBI Official Full Name
LIM domain kinase 1 isoform 1
NCBI Official Synonym Full Names
LIM domain kinase 1
NCBI Official Symbol
LIMK1
NCBI Official Synonym Symbols
LIMK; LIMK-1
NCBI Protein Information
LIM domain kinase 1; LIM motif-containing protein kinase
Protein Family

Similar Products

Product Notes

The LIMK1 (Catalog #AAA6163239) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LIMK1 (LIM Domain Kinase 1, LIMK) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LIMK1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LIMK1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LIMK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.