Mouse LHX6 Monoclonal Antibody | anti-LHX6 antibody

LHX6 (LIM/Homeobox Protein Lhx6, LIM Homeobox Protein 6, LIM/Homeobox Protein Lhx6.1, LHX6.1) (HRP)

Cat. Num. AAA6153310

• Gene Names: LHX6; LHX6.1
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LHX6; Monoclonal Antibody; LHX6 (LIM/Homeobox Protein Lhx6; LIM Homeobox Protein 6; LIM/Homeobox Protein Lhx6.1; LHX6.1) (HRP); anti-LHX6 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3D9
• Specificity: Recognizes human LHX6. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 3574

• Applicable Applications for anti-LHX6 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa274-364 from human LHX6 (NP_055183) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVILFQY*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB)

(LHX6 monoclonal antibody. Western Blot analysis of LHX6 expression in PC-12.)

Western Blot (WB)

(LHX6 monoclonal antibody Western Blot analysis of LHX6 expression in Raw 264.7.)

Related Product Information for anti-LHX6 antibody

Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron precursors from the subpallium to the cerebral cortex.

Product Categories/Family for anti-LHX6 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 1677500174
• NCBI GeneID: 26468
• NCBI Accession #: NM_014368.5
• NCBI GenBank Nucleotide #: NM_014368
• NCBI Official Full Name: Homo sapiens LIM homeobox 6 (LHX6), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: LIM homeobox 6
• NCBI Official Symbol: LHX6
• NCBI Official Synonym Symbols: LHX6.1
• NCBI Protein Information: LIM/homeobox protein Lhx6
• Protein Family: LIM/homeobox protein

NCBI Description

This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein has tandem LIM domains as well as a DNA-binding homeodomain. The protein functions as a transcription factor involved in embryogenesis and head development and is highly expressed in neural crest derived mesenchyme cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jan 2017]