Testing Data
(Detection limit for recombinant GST tagged LGALS7 is 0.03 ng/ml as a capture antibody.)
Mouse LGALS7 Monoclonal Antibody | anti-LGALS7 antibody
LGALS7 (Lectin, Galactoside-Binding, Soluble, 7, GAL7, LGALS7A) (PE)
Gene Names
LGALS7; GAL7; LGALS7A
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
LGALS7; Monoclonal Antibody; LGALS7 (Lectin; Galactoside-Binding; Soluble; 7; GAL7; LGALS7A) (PE); Lectin; LGALS7A; anti-LGALS7 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6B5
Specificity
Recognizes LGALS7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-LGALS7 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
LGALS7 (NP_002298.1, 1aa-136aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged LGALS7 is 0.03 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged LGALS7 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-LGALS7 antibody
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq]
Product Categories/Family for anti-LGALS7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
galectin-7
NCBI Official Synonym Full Names
lectin, galactoside-binding, soluble, 7
NCBI Official Symbol
LGALS7
NCBI Official Synonym Symbols
GAL7; LGALS7A
NCBI Protein Information
galectin-7; galectin 7
Protein Family
NCBI Description
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq, Jul 2008]
Research Articles on LGALS7
Similar Products
Product Notes
The LGALS7 (Catalog #AAA6187968) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LGALS7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LGALS7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LGALS7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
