Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (62.48kD).)

Mouse anti-Human LDHB Monoclonal Antibody | anti-LDHB antibody

LDHB (L-lactate Dehydrogenase B Chain, LDH-B, LDH Heart Subunit, LDH-H, Renal Carcinoma Antigen NY-REN-46) (PE)

Gene Names
LDHB; LDH-B; LDH-H; LDHBD; TRG-5; HEL-S-281
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LDHB; Monoclonal Antibody; LDHB (L-lactate Dehydrogenase B Chain; LDH-B; LDH Heart Subunit; LDH-H; Renal Carcinoma Antigen NY-REN-46) (PE); anti-LDHB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H6
Specificity
Recognizes human LDHB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-LDHB antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-334 from human LDHB (AAH02362.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSDINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (62.48kD).)

Western Blot (WB) (Western Blot detection against Immunogen (62.48kD).)

Western Blot (WB)

(LDHB monoclonal antibody Western Blot analysis of LDHB expression in Hela.)

Western Blot (WB) (LDHB monoclonal antibody Western Blot analysis of LDHB expression in Hela.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LDHB on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to LDHB on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LDHB on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to LDHB on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged LDHB is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LDHB is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-LDHB antibody
References
1. Pilot application of iTRAQ to the retinal disease Macular Telangiectasia. Len AC, Powner MB, Zhu L, Hageman GS, Song X, Fruttiger M, Gillies MC.J Proteome Res. 2011 Nov 21. 2. Quantitative Proteomics Analysis Reveals BAG3 as a Potential Target to Suppress SARS-CoV Replication. Zhang L, Zhang ZP, Zhang XE, Lin FS, Ge F.J Virol. 2010 Apr 14.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
36,638 Da
NCBI Official Full Name
Homo sapiens lactate dehydrogenase B, mRNA
NCBI Official Synonym Full Names
lactate dehydrogenase B
NCBI Official Symbol
LDHB
NCBI Official Synonym Symbols
LDH-B; LDH-H; LDHBD; TRG-5; HEL-S-281
NCBI Protein Information
L-lactate dehydrogenase B chain
Protein Family

NCBI Description

This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have been found for this gene. Recent studies have shown that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on chromosomes X, 5 and 13. [provided by RefSeq, Feb 2016]

Research Articles on LDHB

Similar Products

Product Notes

The LDHB (Catalog #AAA6158593) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LDHB (L-lactate Dehydrogenase B Chain, LDH-B, LDH Heart Subunit, LDH-H, Renal Carcinoma Antigen NY-REN-46) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LDHB can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LDHB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LDHB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.