Mouse anti-Human LDHB Monoclonal Antibody | anti-LDHB antibody

LDHB (L-lactate Dehydrogenase B Chain, LDH-B, LDH Heart Subunit, LDH-H, Renal Carcinoma Antigen NY-REN-46) (HRP)

Cat. Num. AAA6153290

• Gene Names: LDHB; LDH-B; LDH-H; LDHBD; TRG-5; HEL-S-281
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LDHB; Monoclonal Antibody; LDHB (L-lactate Dehydrogenase B Chain; LDH-B; LDH Heart Subunit; LDH-H; Renal Carcinoma Antigen NY-REN-46) (HRP); anti-LDHB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2H6
• Specificity: Recognizes human LDHB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-LDHB antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-334 from human LDHB (AAH02362.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSDINQKLKDDEVAQLKKSADTLWDIQKDLKDL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (62.48kD).)

Western Blot (WB)

(LDHB monoclonal antibody Western Blot analysis of LDHB expression in Hela.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to LDHB on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to LDHB on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged LDHB is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-LDHB antibody

Antibodies; Enzymes; Dehydrogenase

References

1. Pilot application of iTRAQ to the retinal disease Macular Telangiectasia. Len AC, Powner MB, Zhu L, Hageman GS, Song X, Fruttiger M, Gillies MC.J Proteome Res. 2011 Nov 21. 2. Quantitative Proteomics Analysis Reveals BAG3 as a Potential Target to Suppress SARS-CoV Replication. Zhang L, Zhang ZP, Zhang XE, Lin FS, Ge F.J Virol. 2010 Apr 14.

NCBI and Uniprot Product Information

• NCBI GI #: 12803116
• NCBI GeneID: 3945
• Molecular Weight: 36,638 Da
• NCBI Official Full Name: Homo sapiens lactate dehydrogenase B, mRNA
• NCBI Official Synonym Full Names: lactate dehydrogenase B
• NCBI Official Symbol: LDHB
• NCBI Official Synonym Symbols: LDH-B; LDH-H; LDHBD; TRG-5; HEL-S-281
• NCBI Protein Information: L-lactate dehydrogenase B chain
• Protein Family: L-lactate dehydrogenase

NCBI Description

This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have been found for this gene. Recent studies have shown that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on chromosomes X, 5 and 13. [provided by RefSeq, Feb 2016]