Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human LATS1 Monoclonal Antibody | anti-LATS1 antibody

LATS1 (WARTS, Serine/Threonine-protein Kinase LATS1, Large Tumor Suppressor Homolog 1, WARTS Protein Kinase) (FITC)

Gene Names
LATS1; wts; WARTS
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LATS1; Monoclonal Antibody; LATS1 (WARTS; Serine/Threonine-protein Kinase LATS1; Large Tumor Suppressor Homolog 1; WARTS Protein Kinase) (FITC); anti-LATS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A7
Specificity
Recognizes human LATS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
7362
Applicable Applications for anti-LATS1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa521-620 from LATS1 (NP_004681) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PQPIQTVQPSPFPEGTASNVTVMPPVAEAPNYQGPPPPYPKHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENVDSGDKEKKQITTSPITVRKN
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(LATS1 monoclonal antibody Western Blot analysis of LATS1 expression in HeLa)

Western Blot (WB) (LATS1 monoclonal antibody Western Blot analysis of LATS1 expression in HeLa)

Testing Data

(Detection limit for recombinant GST tagged LATS1 is ~10ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LATS1 is ~10ng/ml as a capture antibody.)
Related Product Information for anti-LATS1 antibody
The protein encoded by this gene is a putative serine/threonine kinase that localizes to the mitotic apparatus and complexes with cell cycle controller CDC2 kinase in early mitosis. The protein is phosphorylated in a cell-cycle dependent manner, with late prophase phosphorylation remaining through metaphase. The N-terminal region of the protein binds CDC2 to form a complex showing reduced H1 histone kinase activity, indicating a role as a negative regulator of CDC2/cyclin A. In addition, the C-terminal kinase domain binds to its own N-terminal region, suggesting potential negative regulation through interference with complex formation via intramolecular binding. Biochemical and genetic data suggest a role as a tumor suppressor. This is supported by studies in knockout mice showing development of soft-tissue sarcomas, ovarian stromal cell tumors and a high sensitivity to carcinogenic treatments.
Product Categories/Family for anti-LATS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens large tumor suppressor kinase 1 (LATS1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
large tumor suppressor kinase 1
NCBI Official Symbol
LATS1
NCBI Official Synonym Symbols
wts; WARTS
NCBI Protein Information
serine/threonine-protein kinase LATS1
UniProt Protein Name
Serine/threonine-protein kinase LATS1
UniProt Gene Name
LATS1
UniProt Synonym Gene Names
h-warts

NCBI Description

The protein encoded by this gene is a putative serine/threonine kinase that localizes to the mitotic apparatus and complexes with cell cycle controller CDC2 kinase in early mitosis. The protein is phosphorylated in a cell-cycle dependent manner, with late prophase phosphorylation remaining through metaphase. The N-terminal region of the protein binds CDC2 to form a complex showing reduced H1 histone kinase activity, indicating a role as a negative regulator of CDC2/cyclin A. In addition, the C-terminal kinase domain binds to its own N-terminal region, suggesting potential negative regulation through interference with complex formation via intramolecular binding. Biochemical and genetic data suggest a role as a tumor suppressor. This is supported by studies in knockout mice showing development of soft-tissue sarcomas, ovarian stromal cell tumors and a high sensitivity to carcinogenic treatments. [provided by RefSeq, Apr 2017]

Uniprot Description

LATS1: an AGC kinase of the NDR family of kinases. Localized to the mitotic apparatus and specifically phosphorylated during mitosis. A likely tumor suppressor which plays a critical role in maintenance of ploidy through its actions in both mitotic progression and the G1 tetraploidy checkpoint. Negatively regulates G2/M transition by down-regulating CDC2 kinase activity, causing G2 arrest. Involved in the control of p53 expression. Affects cytokinesis by regulating actin polymerization through negative modulation of LIMK1. Complexes with CDC2 in early mitosis. LATS1-associated CDC2 has no mitotic cyclin partner and no apparent kinase activity. Binds phosphorylated zyxin, locating this protein to the mitotic spindle and suggesting a role for actin regulatory proteins during mitosis. Binds to and colocalizes with LIMK1 at the actomyosin contractile ring during cytokinesis. Knockout mice are susceptible to soft-tissue sarcomas and sensitive to chemical carcinogenesis. Human soft tissue sarcomas have downregulated, mutated, and/or hypermethylated LATS1. Transgenic expression blocks anchorage independent growth in culture and tumor growth in xenografts. Two alternatively spliced isoforms of the human proteinhave been described.

Protein type: AGC group; EC 2.7.11.1; Kinase, protein; NDR family; Protein kinase, AGC; Protein kinase, Ser/Thr (non-receptor); Tumor suppressor

Chromosomal Location of Human Ortholog: 6q25.1

Cellular Component: cytosol; spindle pole

Molecular Function: ATP binding; estrogen receptor binding; magnesium ion binding; protein binding; protein kinase binding; protein serine/threonine kinase activity

Biological Process: cytoplasmic sequestering of protein; G1/S transition of mitotic cell cycle; G2/M transition of mitotic cell cycle; hormone-mediated signaling; negative regulation of cyclin-dependent protein kinase activity; positive regulation of apoptosis; positive regulation of peptidyl-serine phosphorylation; protein amino acid phosphorylation; regulation of actin filament polymerization; regulation of estrogen receptor signaling pathway; regulation of organ growth; regulation of protein complex assembly; sister chromatid segregation

Research Articles on LATS1

Similar Products

Product Notes

The LATS1 lats1 (Catalog #AAA6147978) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LATS1 (WARTS, Serine/Threonine-protein Kinase LATS1, Large Tumor Suppressor Homolog 1, WARTS Protein Kinase) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LATS1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LATS1 lats1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LATS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.