Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human LAMP2 Monoclonal Antibody | anti-LAMP2 antibody

LAMP2 (Lysosome-associated Membrane Glycoprotein 2, LAMP-2, Lysosome-associated Membrane Protein 2, CD107 Antigen-like Family Member B, CD107b) APC

Gene Names
Lamp2; Mac3; LGP-B; CD107b; Lamp-2; Lamp II; Lamp-2a; Lamp-2b; Lamp-2c
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LAMP2; Monoclonal Antibody; LAMP2 (Lysosome-associated Membrane Glycoprotein 2; LAMP-2; Lysosome-associated Membrane Protein 2; CD107 Antigen-like Family Member B; CD107b) APC; anti-LAMP2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G10
Specificity
Recognizes human LAMP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-LAMP2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa30-127 from human LAMP2 (NP_054701) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Testing Data

(Detection limit for recombinant GST tagged LAMP2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged LAMP2 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-LAMP2 antibody
LAMP2 is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome.
Product Categories/Family for anti-LAMP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,655 Da
NCBI Official Full Name
lysosome-associated membrane glycoprotein 2 isoform 2
NCBI Official Synonym Full Names
lysosomal-associated membrane protein 2
NCBI Official Symbol
Lamp2
NCBI Official Synonym Symbols
Mac3; LGP-B; CD107b; Lamp-2; Lamp II; Lamp-2a; Lamp-2b; Lamp-2c
NCBI Protein Information
lysosome-associated membrane glycoprotein 2; lysosomal membrane glycoprotein 2; CD107 antigen-like family member B; lysosomal membrane glycoprotein type B
UniProt Protein Name
Lysosome-associated membrane glycoprotein 2
UniProt Gene Name
Lamp2
UniProt Synonym Gene Names
Lamp-2; LAMP-2; Lysosome-associated membrane protein 2; LGP-B

Uniprot Description

LAMP2: Implicated in tumor cell metastasis. May function in protection of the lysosomal membrane from autodigestion, maintenance of the acidic environment of the lysosome, adhesion when expressed on the cell surface (plasma membrane), and inter- and intracellular signal transduction. Protects cells from the toxic effects of methylating mutagens. Defects in LAMP2 are the cause of Danon disease (DAND); also known as glycogen storage disease type 2B (GSD2B). DAND is a lysosomal glycogen storage disease characterized by the clinical triad of cardiomyopathy, vacuolar myopathy and mental retardation. It is often associated with an accumulation of glycogen in muscle and lysosomes. Belongs to the LAMP family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: X A3.3|X 22.67 cM

Cellular Component: endosome; extracellular space; late endosome; late endosome membrane; lipid raft; lysosomal membrane; lysosome; membrane; phagocytic vesicle membrane; platelet dense granule membrane

Molecular Function: enzyme binding; protein domain specific binding

Biological Process: muscle maintenance; protein stabilization; regulation of protein stability

Research Articles on LAMP2

Similar Products

Product Notes

The LAMP2 lamp2 (Catalog #AAA6137361) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LAMP2 (Lysosome-associated Membrane Glycoprotein 2, LAMP-2, Lysosome-associated Membrane Protein 2, CD107 Antigen-like Family Member B, CD107b) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LAMP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LAMP2 lamp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LAMP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.