Mouse anti-Human LAMP2 Monoclonal Antibody | anti-LAMP2 antibody

LAMP2 (Lysosome-associated Membrane Glycoprotein 2, LAMP-2, Lysosome-associated Membrane Protein 2, CD107 Antigen-like Family Member B, CD107b) (FITC)

Cat. Num. AAA6147967

• Gene Names: Lamp2; Mac3; LGP-B; CD107b; Lamp-2; Lamp II; Lamp-2a; Lamp-2b; Lamp-2c
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LAMP2; Monoclonal Antibody; LAMP2 (Lysosome-associated Membrane Glycoprotein 2; LAMP-2; Lysosome-associated Membrane Protein 2; CD107 Antigen-like Family Member B; CD107b) (FITC); anti-LAMP2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2G10
• Specificity: Recognizes human LAMP2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-LAMP2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa30-127 from human LAMP2 (NP_054701) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Testing Data

(Detection limit for recombinant GST tagged LAMP2 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-LAMP2 antibody

LAMP2 is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome.

Product Categories/Family for anti-LAMP2 antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 31543108
• NCBI GeneID: 16784
• NCBI Accession #: NP_054701
• NCBI GenBank Nucleotide #: NM_013995
• UniProt Accession #: P17047; Q3TXG5; Q8BSG8; A2A430
• Molecular Weight: 45,655 Da
• NCBI Official Full Name: lysosome-associated membrane glycoprotein 2 isoform 2
• NCBI Official Synonym Full Names: lysosomal-associated membrane protein 2
• NCBI Official Symbol: Lamp2
• NCBI Official Synonym Symbols: Mac3; LGP-B; CD107b; Lamp-2; Lamp II; Lamp-2a; Lamp-2b; Lamp-2c
• NCBI Protein Information: lysosome-associated membrane glycoprotein 2; lysosomal membrane glycoprotein 2; CD107 antigen-like family member B; lysosomal membrane glycoprotein type B
• UniProt Protein Name: Lysosome-associated membrane glycoprotein 2
• Protein Family: Lysosome-associated membrane glycoprotein
• UniProt Gene Name: Lamp2
• UniProt Synonym Gene Names: Lamp-2; LAMP-2; Lysosome-associated membrane protein 2; LGP-B

Uniprot Description

LAMP2: Implicated in tumor cell metastasis. May function in protection of the lysosomal membrane from autodigestion, maintenance of the acidic environment of the lysosome, adhesion when expressed on the cell surface (plasma membrane), and inter- and intracellular signal transduction. Protects cells from the toxic effects of methylating mutagens. Defects in LAMP2 are the cause of Danon disease (DAND); also known as glycogen storage disease type 2B (GSD2B). DAND is a lysosomal glycogen storage disease characterized by the clinical triad of cardiomyopathy, vacuolar myopathy and mental retardation. It is often associated with an accumulation of glycogen in muscle and lysosomes. Belongs to the LAMP family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: X A3.3|X 22.67 cM

Cellular Component: endosome; extracellular space; late endosome; late endosome membrane; lipid raft; lysosomal membrane; lysosome; membrane; phagocytic vesicle membrane; platelet dense granule membrane

Molecular Function: enzyme binding; protein domain specific binding

Biological Process: muscle maintenance; protein stabilization; regulation of protein stability