Mouse anti-Human SKP1A Monoclonal Antibody | anti-SKP1A antibody

SKP1A (S-phase Kinase-associated Protein 1, Cyclin-A/CDK2-associated Protein p19, Organ of Corti Protein 2, OCP-2, Organ of Corti Protein II, OCP-II, RNA Polymerase II Elongation Factor-like Protein, SIII, Transcription Elongation Factor B, p19A, p19skp1,

Cat. Num. AAA6160285

• Gene Names: SKP1; OCP2; p19A; EMC19; SKP1A; OCP-II; TCEB1L
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SKP1A; Monoclonal Antibody; SKP1A (S-phase Kinase-associated Protein 1; Cyclin-A/CDK2-associated Protein p19; Organ of Corti Protein 2; OCP-2; Organ of Corti Protein II; OCP-II; RNA Polymerase II Elongation Factor-like Protein; SIII; Transcription Elongation Factor B; p19A; p19skp1; ; anti-SKP1A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1H8
• Specificity: Recognizes human SKP1A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-SKP1A antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa53-161 from human SKP1A (NP_008861) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(SKP1A monoclonal antibody, Western Blot analysis of SKP1A expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of SKP1 expression in transfected 293T cell line by SKP1A monoclonal antibody. Lane 1: SKP1 transfected lysate (18.1kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SKP1A on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-SKP1A antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 25777711
• NCBI GeneID: 6500
• NCBI Accession #: NP_008861
• NCBI GenBank Nucleotide #: NM_006930
• UniProt Accession #: P63208; P34991; Q8TAY2; D3DQ97; D3DQ98
• Molecular Weight: 18 kDa (160aa), confirmed by MALDI-TOF.
• NCBI Official Full Name: S-phase kinase-associated protein 1 isoform a
• NCBI Official Synonym Full Names: S-phase kinase associated protein 1
• NCBI Official Symbol: SKP1
• NCBI Official Synonym Symbols: OCP2; p19A; EMC19; SKP1A; OCP-II; TCEB1L
• NCBI Protein Information: S-phase kinase-associated protein 1
• UniProt Protein Name: S-phase kinase-associated protein 1
• Protein Family: SKP1-like protein
• UniProt Gene Name: SKP1
• UniProt Synonym Gene Names: EMC19; OCP2; SKP1A; TCEB1L; OCP-2; OCP-II
• UniProt Entry Name: SKP1_HUMAN

NCBI Description

This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7. [provided by RefSeq, Jul 2008]

Uniprot Description

SKP1A: Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. SCF(BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF(Cyclin F) directs ubiquitination of CP110. Component of an E3 ubiquitin ligase complex containing UBE2D1, SIAH1, CACYBP/SIP, SKP1, APC and TBL1X. Component of the SCF(BTRC) complex, composed of SKP1, CUL1 and BTRC. Part of a SCF(BTRC)-like complex lacking CUL1, which is associated with phosphorylated NFKBIA and RELA; RELA interacts directly with NFKBIA. Component of the SCF(FBXO44) complex, composed of SKP1, CUL1 and FBXO44. Identified in a complex with SKP2, CKS1B and p27Kip1. Interacts with the cyclin A/CDK2 complex. Part of a SCF- like complex consisting of CUL7, RBX1, SKP1 and FBXW8. Part of several SCF complexes containing SKP1 and one of the F-box proteins. Component of a SCF(SKP2)-like complex containing CUL1, SKP1, TRIM21 and SKP2. Interacts with FBXO2, FBXO4, FBXW7 and TRIM21. Interacts with FBXO45. Component of the SCF(FBXO17) complex, composed of SKP1, CUL1 and FBXO17. Component of the SCF(FBXO27) complex, composed of SKP1, CUL1 and FBXO27. Component of the SCF(Cyclin F) complex consisting of CUL1, RBX1, SKP1 and CCNF. Belongs to the SKP1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: nucleoplasm; SCF ubiquitin ligase complex; PcG protein complex; cytosol

Molecular Function: protein binding; ubiquitin-protein ligase activity

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; circadian rhythm; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process; Notch signaling pathway; viral reproduction; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; protein ubiquitination; mitotic cell cycle; G2/M transition of mitotic cell cycle; G1/S transition of mitotic cell cycle