Testing Data
(Detection limit for recombinant GST tagged KYNU is ~0.1ng/ml as a capture antibody.)
Mouse anti-Human KYNU Monoclonal Antibody | anti-KYNU antibody
KYNU (Kynureninase, L-kynurenine Hydrolase) APC
Gene Names
KYNU; KYNUU; VCRL2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KYNU; Monoclonal Antibody; KYNU (Kynureninase; L-kynurenine Hydrolase) APC; anti-KYNU antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a
Clone Number
1G2
Specificity
Recognizes human KYNU.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-KYNU antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-109 from human KYNU (NP_003928) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRP
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged KYNU is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged KYNU is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-KYNU antibody
KYNU is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. KYNU is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway.
Product Categories/Family for anti-KYNU antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
kynureninase isoform a
NCBI Official Synonym Full Names
kynureninase
NCBI Official Symbol
KYNU
NCBI Official Synonym Symbols
KYNUU; VCRL2
NCBI Protein Information
kynureninase
UniProt Protein Name
Kynureninase
Protein Family
UniProt Gene Name
KYNU
UniProt Entry Name
KYNU_HUMAN
NCBI Description
Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]
Research Articles on KYNU
Similar Products
Product Notes
The KYNU kynu (Catalog #AAA6137352) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KYNU (Kynureninase, L-kynurenine Hydrolase) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KYNU can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KYNU kynu for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KYNU, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
