Mouse anti-Human KLRC1 Monoclonal Antibody | anti-KLRC1 antibody

KLRC1 (Killer Cell Lectin-like Receptor Subfamily C Member 1, CD159 Antigen-like Family Member A, CD159a, NK Cell Receptor A, NKG2A, NKG2, NKG2-A/B-activating NK Receptor, NKG2-A/NKG2-B Type II Integral Membrane Protein, MGC13374, MGC59791) (AP)

Cat. Num. AAA6132025

• Gene Names: KLRC1; NKG2; NKG2A; CD159A
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KLRC1; Monoclonal Antibody; KLRC1 (Killer Cell Lectin-like Receptor Subfamily C Member 1; CD159 Antigen-like Family Member A; CD159a; NK Cell Receptor A; NKG2A; NKG2; NKG2-A/B-activating NK Receptor; NKG2-A/NKG2-B Type II Integral Membrane Protein; MGC13374; MGC59791) (AP); anti-KLRC1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C3
• Specificity: Recognizes human KLRC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-KLRC1 antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-70 from human KLRC1 (NP_998823) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of KLRC1 transfected lysate using KLRC1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KLRC1 rabbit polyclonal antibody.)

Related Product Information for anti-KLRC1 antibody

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.

Product Categories/Family for anti-KLRC1 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 47717094
• NCBI GeneID: 3821
• NCBI Accession #: NP_998823
• NCBI GenBank Nucleotide #: NM_213658
• UniProt Accession #: P26715
• Molecular Weight: 17.1kDa (149aa) 18-28KDa (SDS-PAGE under reducing conditions.)
• NCBI Official Full Name: NKG2-A/NKG2-B type II integral membrane protein isoform NKG2-A
• NCBI Official Synonym Full Names: killer cell lectin like receptor C1
• NCBI Official Symbol: KLRC1
• NCBI Official Synonym Symbols: NKG2; NKG2A; CD159A
• NCBI Protein Information: NKG2-A/NKG2-B type II integral membrane protein
• UniProt Protein Name: NKG2-A/NKG2-B type II integral membrane protein
• UniProt Gene Name: KLRC1
• UniProt Synonym Gene Names: NKG2A
• UniProt Entry Name: NKG2A_HUMAN

NCBI Description

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jan 2015]

Uniprot Description

NKG2A: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: integral to plasma membrane; plasma membrane; receptor complex

Molecular Function: protein binding; transmembrane receptor activity; carbohydrate binding

Biological Process: regulation of immune response; cell surface receptor linked signal transduction