Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KLRC1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Rabbit KLRC1 Polyclonal Antibody | anti-KLRC1 antibody

KLRC1 antibody - N-terminal region

Gene Names
KLRC1; NKG2; NKG2A; CD159A
Reactivity
Guinea Pig, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KLRC1; Polyclonal Antibody; KLRC1 antibody - N-terminal region; anti-KLRC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PKRQQRKPKGNKSSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPS
Sequence Length
233
Applicable Applications for anti-KLRC1 antibody
Western Blot (WB)
Homology
Guinea Pig: 79%; Human: 100%; Mouse: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KLRC1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Western Blot (WB) (WB Suggested Anti-KLRC1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
Related Product Information for anti-KLRC1 antibody
This is a rabbit polyclonal antibody against KLRC1. It was validated on Western Blot

Target Description: Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Four alternatively spliced transcript variants encoding two distinct isoforms have been observed.
Product Categories/Family for anti-KLRC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
NKG2-A/NKG2-B type II integral membrane protein isoform NKG2-A
NCBI Official Synonym Full Names
killer cell lectin like receptor C1
NCBI Official Symbol
KLRC1
NCBI Official Synonym Symbols
NKG2; NKG2A; CD159A
NCBI Protein Information
NKG2-A/NKG2-B type II integral membrane protein
UniProt Protein Name
NKG2-A/NKG2-B type II integral membrane protein
UniProt Gene Name
KLRC1
UniProt Synonym Gene Names
NKG2A
UniProt Entry Name
NKG2A_HUMAN

NCBI Description

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor family, also called NKG2 family, which is a group of transmembrane proteins preferentially expressed in NK cells. This family of proteins is characterized by the type II membrane orientation and the presence of a C-type lectin domain. This protein forms a complex with another family member, KLRD1/CD94, and has been implicated in the recognition of the MHC class I HLA-E molecules in NK cells. The genes of NKG2 family members form a killer cell lectin-like receptor gene cluster on chromosome 12. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jan 2015]

Uniprot Description

NKG2A: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: integral to plasma membrane; plasma membrane; receptor complex

Molecular Function: protein binding; transmembrane receptor activity; carbohydrate binding

Biological Process: regulation of immune response; cell surface receptor linked signal transduction

Research Articles on KLRC1

Similar Products

Product Notes

The KLRC1 klrc1 (Catalog #AAA3215168) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLRC1 antibody - N-terminal region reacts with Guinea Pig, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KLRC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLRC1 klrc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PKRQQRKPKG NKSSILATEQ EITYAELNLQ KASQDFQGND KTYHCKDLPS. It is sometimes possible for the material contained within the vial of "KLRC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.