Mouse anti-Human, Rat KLF7 Monoclonal Antibody | anti-KLF7 antibody

KLF7 (Kruppel-like Factor 7, Ubiquitous Krueppel-like Factor, UKLF) (AP)

Cat. Num. AAA6132010

• Gene Names: KLF7; UKLF
• Reactivity: Human, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KLF7; Monoclonal Antibody; KLF7 (Kruppel-like Factor 7; Ubiquitous Krueppel-like Factor; UKLF) (AP); anti-KLF7 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3E8-B8
• Specificity: Recognizes human KLF7. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-KLF7 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-231 from KLF7 (AAH12919) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVRSLISAHGRDVSGVLHEAMSSRGTTGNTQVQSPSNATTATGVFPGLTILPST*
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (51.41kD).)

Western Blot (WB)

(KLF7 monoclonal antibody, Western Blot analysis of KLF7 expression in PC-12.)

Western Blot (WB)

(KLF7 monoclonal antibody Western Blot analysis of KLF7 expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged KLF7 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-KLF7 antibody

Transcriptional activator. Binds in vitro to the CACCC motif of the beta-globin promoter and to the SP1 recognition sequence.

Product Categories/Family for anti-KLF7 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 15341758
• NCBI GeneID: 8609
• Molecular Weight: 9,295 Da
• NCBI Official Full Name: Homo sapiens Kruppel-like factor 7 (ubiquitous), mRNA
• NCBI Official Synonym Full Names: Kruppel like factor 7
• NCBI Official Symbol: KLF7
• NCBI Official Synonym Symbols: UKLF
• NCBI Protein Information: Krueppel-like factor 7
• Protein Family: Krueppel-like factor

NCBI Description

The protein encoded by this gene is a member of the Kruppel-like transcriptional regulator family. Members in this family regulate cell proliferation, differentiation and survival and contain three C2H2 zinc fingers at the C-terminus that mediate binding to GC-rich sites. This protein may contribute to the progression of type 2 diabetes by inhibiting insulin expression and secretion in pancreatic beta-cells and by deregulating adipocytokine secretion in adipocytes. A pseudogene of this gene is located on the long arm of chromosome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]