Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human KLF6 Monoclonal Antibody | anti-KLF6 antibody

KLF6 (Kruppel-like Factor 6, B-cell derived 1, Core promoter Element Binding Protein, Core Promoter Element-Binding Protein, N-terminus truncated, Prostate Adenocarcinoma-1, Protooncogene BCD1, Suppression of tumorigenicity 12 (prostate), BCD1, COPEB, CPB

Gene Names
KLF6; GBF; ZF9; BCD1; CBA1; CPBP; PAC1; ST12; COPEB
Reactivity
Human
Applications
ELISA, Immunofluorescence
Purity
Purified
Synonyms
KLF6; Monoclonal Antibody; KLF6 (Kruppel-like Factor 6; B-cell derived 1; Core promoter Element Binding Protein; Core Promoter Element-Binding Protein; N-terminus truncated; Prostate Adenocarcinoma-1; Protooncogene BCD1; Suppression of tumorigenicity 12 (prostate); BCD1; COPEB; CPB; anti-KLF6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C4
Specificity
Recognizes human KLF6.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-KLF6 antibody
ELISA (EIA), Immunofluorescence (IF)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa1-100 from human KLF6 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLE LERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEES ELKISSSPPEDTLISPSFCYNLE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-KLF6 antibody
This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis.
Product Categories/Family for anti-KLF6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.3 kDa (306aa) confirmed by MALDI-TOF
NCBI Official Full Name
Krueppel-like factor 6 isoform A
NCBI Official Synonym Full Names
Kruppel like factor 6
NCBI Official Symbol
KLF6
NCBI Official Synonym Symbols
GBF; ZF9; BCD1; CBA1; CPBP; PAC1; ST12; COPEB
NCBI Protein Information
Krueppel-like factor 6
UniProt Protein Name
Krueppel-like factor 6
Protein Family
UniProt Gene Name
KLF6
UniProt Synonym Gene Names
BCD1; COPEB; CPBP; ST12
UniProt Entry Name
KLF6_HUMAN

NCBI Description

This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis. [provided by RefSeq, May 2009]

Uniprot Description

KLF6: Transcriptional activator. Binds a GC box motif. Could play a role in B-cell growth and development. Defects in KLF6 are a cause of gastric cancer (GASC); also called gastric cancer intestinal or stomach cancer. Gastric cancer is a malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease. Defects in KLF6 are a cause of prostate cancer (PC). Prostate cancer is a malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 10p15

Cellular Component: cytoplasm; nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; B cell differentiation; cytokine and chemokine mediated signaling pathway

Disease: Gastric Cancer; Prostate Cancer

Research Articles on KLF6

Similar Products

Product Notes

The KLF6 klf6 (Catalog #AAA6140154) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KLF6 (Kruppel-like Factor 6, B-cell derived 1, Core promoter Element Binding Protein, Core Promoter Element-Binding Protein, N-terminus truncated, Prostate Adenocarcinoma-1, Protooncogene BCD1, Suppression of tumorigenicity 12 (prostate), BCD1, COPEB, CPB reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLF6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLF6 klf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLF6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.