<
Western Blot (WB)
(Western Blot detection against Immunogen (36.41kD).)
Mouse anti-Human KIFC1 Monoclonal Antibody | anti-KIFC1 antibody
KIFC1 (Kinesin-like Protein KIFC1, Kinesin-like Protein 2, Kinesin-related Protein HSET, HSET, KNSL2, MGC1202, MGC149736, MGC149737)
Gene Names
KIFC1; HSET; KNSL2
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Purified by Protein A affinity chromatography.
Synonyms
KIFC1; Monoclonal Antibody; KIFC1 (Kinesin-like Protein KIFC1; Kinesin-like Protein 2; Kinesin-related Protein HSET; HSET; KNSL2; MGC1202; MGC149736; MGC149737); Anti -KIFC1 (Kinesin-like Protein KIFC1; anti-KIFC1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B9
Specificity
Recognizes human KIFC1.
Purity/Purification
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Concentration
1mg/mL (varies by lot)
Sequence
MDPQRSPLLEVKGNIELKRPLIKAPSQLPLSGSRLKRRPDQMEDGLEPEKKRTRGLGATTKITTSHPRVPSLTTVPQTQGQTTAQKVSKKTGPRCSTAIA
Applicable Applications for anti-KIFC1 antibody
ELISA (EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
IF: 10ug/ml
IHC (Formalin fixed paraffin embedded): 3ug/ml
Other dilutions should be determined by the researcher.
IHC (Formalin fixed paraffin embedded): 3ug/ml
Other dilutions should be determined by the researcher.
Immunogen
Partial recombinant corresponding to aa53-152 from human KIFC1 with GST tag. MW of the GST tag alone is 26kD.
Grade
Affinity Purified
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.41kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.41kD).)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to KIFC1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to KIFC1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to KIFC1 on HeLa cell. [antibody concentration 10ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to KIFC1 on HeLa cell. [antibody concentration 10ug/ml])
Testing Data
(Detection limit for recombinant GST tagged KIFC1 is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged KIFC1 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-KIFC1 antibody
Minus end-directed microtubule-dependent motor required for bipolar spindle formation. May contribute to movement of early endocytic vesicles.
Product Categories/Family for anti-KIFC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
kinesin-like protein KIFC1
NCBI Official Synonym Full Names
kinesin family member C1
NCBI Official Symbol
KIFC1
NCBI Official Synonym Symbols
HSET; KNSL2
NCBI Protein Information
kinesin-like protein KIFC1; kinesin-like 2; kinesin-like protein 2; kinesin-related protein HSET
UniProt Protein Name
Kinesin-like protein KIFC1
Protein Family
UniProt Gene Name
KIFC1
UniProt Synonym Gene Names
HSET; KNSL2
UniProt Entry Name
KIFC1_HUMAN
Uniprot Description
KIFC1: Minus end-directed microtubule-dependent motor required for bipolar spindle formation. May contribute to movement of early endocytic vesicles. Belongs to the kinesin-like protein family. NCD subfamily. Binds NUBP1 and NUBP2.
Protein type: Motility/polarity/chemotaxis; Motor; Microtubule-binding
Chromosomal Location of Human Ortholog: 6p21.3
Cellular Component: microtubule; kinesin complex; membrane; early endosome; microtubule organizing center; spindle; nucleus
Molecular Function: minus-end-directed microtubule motor activity; microtubule binding; ATPase activity; microtubule motor activity; ATP binding
Biological Process: mitotic sister chromatid segregation; cell division; metabolic process; spindle assembly; blood coagulation; mitotic metaphase plate congression; microtubule-based movement
Research Articles on KIFC1
Similar Products
Product Notes
The KIFC1 kifc1 (Catalog #AAA6003189) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KIFC1 (Kinesin-like Protein KIFC1, Kinesin-like Protein 2, Kinesin-related Protein HSET, HSET, KNSL2, MGC1202, MGC149736, MGC149737) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KIFC1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). IF: 10ug/ml IHC (Formalin fixed paraffin embedded): 3ug/ml Other dilutions should be determined by the researcher. Researchers should empirically determine the suitability of the KIFC1 kifc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDPQRSPLLE VKGNIELKRP LIKAPSQLPL SGSRLKRRPD QMEDGLEPEK KRTRGLGATT KITTSHPRVP SLTTVPQTQG QTTAQKVSKK TGPRCSTAIA. It is sometimes possible for the material contained within the vial of "KIFC1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
