Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD) using 128752.)

Mouse anti-Human KCNMB3 Monoclonal Antibody | anti-KCNMB3 antibody

KCNMB3 (Calcium-activated Potassium Channel Subunit beta-3, BK Channel Subunit beta-3, BKbeta3, Hbeta3, Calcium-activated Potassium Channel, Subfamily M Subunit beta-3, Charybdotoxin Receptor Subunit beta-3, K(VCA)beta-3, Maxi K Channel Subunit beta-3, Sl

Gene Names
KCNMB3; HBETA3; KCNMB2; KCNMBL; BKBETA3; SLOBETA3; SLO-BETA-3; K(VCA)BETA-3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KCNMB3; Monoclonal Antibody; KCNMB3 (Calcium-activated Potassium Channel Subunit beta-3; BK Channel Subunit beta-3; BKbeta3; Hbeta3; Calcium-activated Potassium Channel; Subfamily M Subunit beta-3; Charybdotoxin Receptor Subunit beta-3; K(VCA)beta-3; Maxi K Channel Subunit beta-3; Sl; anti-KCNMB3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5H1
Specificity
Recognizes human KCNMB3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-KCNMB3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa82-182 from human KCNMB3 (NP_741979) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQGKYPCLQVFVNLSHPGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDHKNG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD) using 128752.)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD) using 128752.)

Testing Data

(Detection limit for 128752 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for 128752 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-KCNMB3 antibody
Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Alters the functional properties of the current expressed by the KCNMA1 channel. Isoform 2, isoform 3 and isoform 4 partially inactivate the current of KCNBMA. Isoform 4 induces a fast and incomplete inactivation of KCNMA1 channel that is detectable only at large depolarizations. In contrast, isoform 1 does not induce detectable inactivation of KCNMA1. Two or more subunits of KCNMB3 are required to block the KCNMA1 tetramer.
Product Categories/Family for anti-KCNMB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
calcium-activated potassium channel subunit beta-3 isoform a
NCBI Official Synonym Full Names
potassium calcium-activated channel subfamily M regulatory beta subunit 3
NCBI Official Symbol
KCNMB3
NCBI Official Synonym Symbols
HBETA3; KCNMB2; KCNMBL; BKBETA3; SLOBETA3; SLO-BETA-3; K(VCA)BETA-3
NCBI Protein Information
calcium-activated potassium channel subunit beta-3
UniProt Protein Name
Calcium-activated potassium channel subunit beta-3
UniProt Gene Name
KCNMB3
UniProt Synonym Gene Names
KCNMB2; KCNMBL; BKbeta3; Hbeta3

NCBI Description

MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the modulatory beta subunit. The protein encoded by this gene is an auxiliary beta subunit which may partially inactivate or slightly decrease the activation time of MaxiK alpha subunit currents. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 22. [provided by RefSeq, Jul 2009]

Uniprot Description

Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Alters the functional properties of the current expressed by the KCNMA1 channel. Isoform 2, isoform 3 and isoform 4 partially inactivate the current of KCNBMA. Isoform 4 induces a fast and incomplete inactivation of KCNMA1 channel that is detectable only at large depolarizations. In contrast, isoform 1 does not induce detectable inactivation of KCNMA1. Two or more subunits of KCNMB3 are required to block the KCNMA1 tetramer.

Research Articles on KCNMB3

Similar Products

Product Notes

The KCNMB3 kcnmb3 (Catalog #AAA6131971) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KCNMB3 (Calcium-activated Potassium Channel Subunit beta-3, BK Channel Subunit beta-3, BKbeta3, Hbeta3, Calcium-activated Potassium Channel, Subfamily M Subunit beta-3, Charybdotoxin Receptor Subunit beta-3, K(VCA)beta-3, Maxi K Channel Subunit beta-3, Sl reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCNMB3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KCNMB3 kcnmb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCNMB3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.