Mouse anti-Human KCNJ15 Monoclonal Antibody | anti-KCNJ15 antibody

KCNJ15 (KCNJ14, ATP-sensitive Inward Rectifier Potassium Channel 15, Inward Rectifier K(+) Channel Kir1.3, Inward Rectifier K(+) Channel Kir4.2, Potassium Channel, Inwardly Rectifying Subfamily J Member 15, MGC13584) (HRP)

Cat. Num. AAA6153180

• Gene Names: KCNJ15; IRKK; KIR1.3; KIR4.2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KCNJ15; Monoclonal Antibody; KCNJ15 (KCNJ14; ATP-sensitive Inward Rectifier Potassium Channel 15; Inward Rectifier K(+) Channel Kir1.3; Inward Rectifier K(+) Channel Kir4.2; Potassium Channel; Inwardly Rectifying Subfamily J Member 15; MGC13584) (HRP); anti-KCNJ15 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B2
• Specificity: Recognizes human KCNJ15.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 375

• Applicable Applications for anti-KCNJ15 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa290-355 from human KCNJ15 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TSAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKY
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33kD) usingMBS649976.)

Western Blot (WB)

(Western Blot analysis of KCNJ15 expression in transfected 293T cell line usingMBS649976. Lane 1: KCNJ15 transfected lysate (42.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western Blot analysis of KCNJ15 over-expressed 293 cell line, cotransfected with KCNJ15 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed withMBS649976. GAPDH (36.1kD) used as specificity and loading control.)

Testing Data

(Detection limit for recombinant GST tagged KCNJ15 is 3ng/ml using MBS649976 as a capture antibody.)

Related Product Information for anti-KCNJ15 antibody

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene.

Product Categories/Family for anti-KCNJ15 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 21361127
• NCBI GeneID: 3772
• NCBI Accession #: NP_002234
• NCBI GenBank Nucleotide #: NM_002243
• UniProt Accession #: Q99712
• NCBI Official Full Name: ATP-sensitive inward rectifier potassium channel 15
• NCBI Official Synonym Full Names: potassium inwardly rectifying channel subfamily J member 15
• NCBI Official Symbol: KCNJ15
• NCBI Official Synonym Symbols: IRKK; KIR1.3; KIR4.2
• NCBI Protein Information: ATP-sensitive inward rectifier potassium channel 15
• UniProt Protein Name: ATP-sensitive inward rectifier potassium channel 15
• Protein Family: ATP-sensitive inward rectifier potassium channel
• UniProt Gene Name: KCNJ15
• UniProt Synonym Gene Names: KCNJ14

NCBI Description

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Eight transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Feb 2013]

Uniprot Description

Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium.