Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Mouse KCNC3 Monoclonal Antibody | anti-KCNC3 antibody

KCNC3 (Potassium Voltage-gated Channel Subfamily C Member 3, KSHIIID, Voltage-gated Potassium Channel Subunit Kv3.3) (MaxLight 405)

Gene Names
KCNC3; KV3.3; SCA13; KSHIIID
Reactivity
Human, Mouse
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KCNC3; Monoclonal Antibody; KCNC3 (Potassium Voltage-gated Channel Subfamily C Member 3; KSHIIID; Voltage-gated Potassium Channel Subunit Kv3.3) (MaxLight 405); anti-KCNC3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C1
Specificity
Recognizes human KCNC3. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-KCNC3 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa671-757 from human KCNC3 (NP_004968) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-KCNC3 antibody
References
1. Volumetric and ionic regulation during the in vitro development of a corneal endothelial barrier. Alaminos A, Gonzalez-Andrades M, Munoz-Avila JI, Garzon I, Sanchez-Quevedo MC, Campos A.Exp Eye Res. 2008 May;86(5):758-69. Epub 2008 Feb 26.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80,578 Da
NCBI Official Full Name
potassium voltage-gated channel subfamily C member 3
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily C member 3
NCBI Official Symbol
KCNC3
NCBI Official Synonym Symbols
KV3.3; SCA13; KSHIIID
NCBI Protein Information
potassium voltage-gated channel subfamily C member 3
UniProt Protein Name
Potassium voltage-gated channel subfamily C member 3
UniProt Gene Name
KCNC3
UniProt Entry Name
KCNC3_HUMAN

NCBI Description

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. Alternate splicing results in several transcript variants. [provided by RefSeq, Mar 2014]

Uniprot Description

Kv3.3: This protein mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Defects in KCNC3 are the cause of spinocerebellar ataxia type 13 (SCA13). Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA13 is an autosomal dominant cerebellar ataxia (ADCA) characterized by slow progression and variable age at onset, ranging from childhood to late adulthood. Mental retardation can be present in some patients. Belongs to the potassium channel family. C (Shaw) (TC 1.A.1.2) subfamily. Kv3.3/KCNC3 sub-subfamily.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: voltage-gated potassium channel complex; integral to membrane; plasma membrane; nerve terminal; axolemma; neuromuscular junction

Molecular Function: voltage-gated potassium channel activity; delayed rectifier potassium channel activity

Biological Process: synaptic transmission; regulation of neurotransmitter secretion; potassium ion transport; protein homooligomerization

Disease: Spinocerebellar Ataxia 13

Research Articles on KCNC3

Similar Products

Product Notes

The KCNC3 kcnc3 (Catalog #AAA6190821) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KCNC3 (Potassium Voltage-gated Channel Subfamily C Member 3, KSHIIID, Voltage-gated Potassium Channel Subunit Kv3.3) (MaxLight 405) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KCNC3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KCNC3 kcnc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCNC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.