Mouse anti-Human, Mouse KCNC3 Monoclonal Antibody | anti-KCNC3 antibody

KCNC3 (Potassium Voltage-gated Channel Subfamily C Member 3, KSHIIID, Voltage-gated Potassium Channel Subunit Kv3.3) (Biotin)

Cat. Num. AAA6142564

• Gene Names: KCNC3; KV3.3; SCA13; KSHIIID
• Reactivity: Human, Mouse
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KCNC3; Monoclonal Antibody; KCNC3 (Potassium Voltage-gated Channel Subfamily C Member 3; KSHIIID; Voltage-gated Potassium Channel Subunit Kv3.3) (Biotin); anti-KCNC3 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1C1
• Specificity: Recognizes human KCNC3. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-KCNC3 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa671-757 from human KCNC3 (NP_004968) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.31kD).)

Western Blot (WB)

(KCNC3 monoclonal antibody Western Blot analysis of KCNC3 expression in NIH/3T3.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to KCNC3 on NIH/3T3 cell. [antibody concentration 10ug/ml])

Product Categories/Family for anti-KCNC3 antibody

Antibodies; Ion Channel

References

1. Volumetric and ionic regulation during the in vitro development of a corneal endothelial barrier. Alaminos A, Gonzalez-Andrades M, Munoz-Avila JI, Garzon I, Sanchez-Quevedo MC, Campos A.Exp Eye Res. 2008 May;86(5):758-69. Epub 2008 Feb 26.

NCBI and Uniprot Product Information

• NCBI GI #: 24497460
• NCBI GeneID: 3748
• NCBI Accession #: NP_004968
• NCBI GenBank Nucleotide #: NM_004977
• UniProt Accession #: Q14003
• Molecular Weight: 80,578 Da
• NCBI Official Full Name: potassium voltage-gated channel subfamily C member 3
• NCBI Official Synonym Full Names: potassium voltage-gated channel subfamily C member 3
• NCBI Official Symbol: KCNC3
• NCBI Official Synonym Symbols: KV3.3; SCA13; KSHIIID
• NCBI Protein Information: potassium voltage-gated channel subfamily C member 3
• UniProt Protein Name: Potassium voltage-gated channel subfamily C member 3
• Protein Family: Potassium voltage-gated channel subfamily
• UniProt Gene Name: KCNC3
• UniProt Entry Name: KCNC3_HUMAN

NCBI Description

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. Alternate splicing results in several transcript variants. [provided by RefSeq, Mar 2014]

Uniprot Description

Kv3.3: This protein mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Defects in KCNC3 are the cause of spinocerebellar ataxia type 13 (SCA13). Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA13 is an autosomal dominant cerebellar ataxia (ADCA) characterized by slow progression and variable age at onset, ranging from childhood to late adulthood. Mental retardation can be present in some patients. Belongs to the potassium channel family. C (Shaw) (TC 1.A.1.2) subfamily. Kv3.3/KCNC3 sub-subfamily.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: voltage-gated potassium channel complex; integral to membrane; plasma membrane; nerve terminal; axolemma; neuromuscular junction

Molecular Function: voltage-gated potassium channel activity; delayed rectifier potassium channel activity

Biological Process: synaptic transmission; regulation of neurotransmitter secretion; potassium ion transport; protein homooligomerization

Disease: Spinocerebellar Ataxia 13