Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human KCNA3 Monoclonal Antibody

KCNA3 (HGK5, Potassium Voltage-gated Channel Subfamily A Member 3, HLK3, HPCN3, Voltage-gated K(+) Channel HuKIII, Voltage-gated Potassium Channel Subunit Kv1.3)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
KCNA3; Monoclonal Antibody; KCNA3 (HGK5; Potassium Voltage-gated Channel Subfamily A Member 3; HLK3; HPCN3; Voltage-gated K(+) Channel HuKIII; Voltage-gated Potassium Channel Subunit Kv1.3); Anti -KCNA3 (HGK5; anti-KCNA3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D8
Specificity
Recognizes human KCNA3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
VPVIVSNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
Applicable Applications for anti-KCNA3 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa424-523 from human KCNA3 (AAH35059) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(KCNA3 monoclonal antibody Western Blot analysis of KCNA3 expression in HeLa NE.)

Western Blot (WB) (KCNA3 monoclonal antibody Western Blot analysis of KCNA3 expression in HeLa NE.)

Testing Data

(Detection limit for recombinant GST tagged KCNA3 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KCNA3 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-KCNA3 antibody
Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1.
Product Categories/Family for anti-KCNA3 antibody

Similar Products

Product Notes

The KCNA3 (Catalog #AAA6004024) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KCNA3 (HGK5, Potassium Voltage-gated Channel Subfamily A Member 3, HLK3, HPCN3, Voltage-gated K(+) Channel HuKIII, Voltage-gated Potassium Channel Subunit Kv1.3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCNA3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the KCNA3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VPVIVSNFNY FYHRETEGEE QSQYMHVGSC QHLSSSAEEL RKARSNSTLS KSEYMVIEEG GMNHSAFPQT PFKTGNSTAT CTTNNNPNSC VNIKKIFTDV. It is sometimes possible for the material contained within the vial of "KCNA3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.