Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (49.87kD).)

Mouse anti-Human KChIP1 Monoclonal Antibody | anti-KChIP1 antibody

KChIP1 (Kv Channel-interacting Protein 1, KChIP1, A-type Potassium Channel Modulatory Protein 1, Potassium Channel-interacting Protein 1, Vesicle APC-binding Protein, KCNIP1, VABP, MGC95) (FITC)

Gene Names
KCNIP1; VABP; KCHIP1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KChIP1; Monoclonal Antibody; KChIP1 (Kv Channel-interacting Protein 1; A-type Potassium Channel Modulatory Protein 1; Potassium Channel-interacting Protein 1; Vesicle APC-binding Protein; KCNIP1; VABP; MGC95) (FITC); anti-KChIP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D9
Specificity
Recognizes human KCNIP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1849
Applicable Applications for anti-KChIP1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-217 from human KCNIP1 (AAH50375) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (49.87kD).)

Western Blot (WB) (Western Blot detection against Immunogen (49.87kD).)

Western Blot (WB)

(Western Blot analysis of KCNIP1 expression in transfected 293T cell line by KCNIP1 monoclonal antibody. Lane 1: KCNIP1 transfected lysate (25.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KCNIP1 expression in transfected 293T cell line by KCNIP1 monoclonal antibody. Lane 1: KCNIP1 transfected lysate (25.2kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged KCNIP1 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KCNIP1 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-KChIP1 antibody
Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND1/Kv4.1 and KCND2/Kv4.2 currents. Seems to be involved in KCND2 trafficking to the cell surface.
Product Categories/Family for anti-KChIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Homo sapiens Kv channel interacting protein 1, mRNA
NCBI Official Synonym Full Names
potassium voltage-gated channel interacting protein 1
NCBI Official Symbol
KCNIP1
NCBI Official Synonym Symbols
VABP; KCHIP1
NCBI Protein Information
Kv channel-interacting protein 1
UniProt Protein Name
Kv channel-interacting protein 1
UniProt Gene Name
KCNIP1
UniProt Synonym Gene Names
KCHIP1; VABP; KChIP1
UniProt Entry Name
KCIP1_HUMAN

NCBI Description

This gene encodes a member of the family of cytosolic voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the neuronal calcium sensor (NCS) family of the calcium binding EF-hand proteins. They associate with Kv4 alpha subunits to form native Kv4 channel complexes. The encoded protein may regulate rapidly inactivating (A-type) currents, and hence neuronal membrane excitability, in response to changes in the concentration of intracellular calcium. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]

Uniprot Description

KCNIP1: Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND1/Kv4.1 and KCND2/Kv4.2 currents. Seems to be involved in KCND2 trafficking to the cell surface. Belongs to the recoverin family. 4 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 5q35.1

Cellular Component: voltage-gated potassium channel complex; extrinsic to internal side of plasma membrane; cell soma; cytoplasm; dendrite

Molecular Function: protein binding; potassium channel regulator activity; potassium channel activity; protein heterodimerization activity; protein N-terminus binding; voltage-gated ion channel activity; calcium ion binding

Biological Process: positive regulation of action potential

Research Articles on KChIP1

Similar Products

Product Notes

The KChIP1 kcnip1 (Catalog #AAA6147873) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KChIP1 (Kv Channel-interacting Protein 1, KChIP1, A-type Potassium Channel Modulatory Protein 1, Potassium Channel-interacting Protein 1, Vesicle APC-binding Protein, KCNIP1, VABP, MGC95) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KChIP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KChIP1 kcnip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KChIP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.