Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (KCNIP2 rabbit polyclonal antibody. WesterKCNIP2 rabbit polyclonal antibody. Western Blot analysis of KCNIP2 expression in A-431.n Blot analysis of KCNIP2 expression in human kidney.)

Rabbit anti-Human KCNIP2 Polyclonal Antibody | anti-KCNIP2 antibody

KCNIP2 (Kv Channel-interacting Protein 2, KChIP2, A-type Potassium Channel Modulatory Protein 2, Cardiac Voltage-gated Potassium Channel Modulatory Subunit, Potassium Channel-interacting Protein 2, DKFZp566L1246, MGC17241) (FITC)

Gene Names
KCNIP2; KCHIP2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KCNIP2; Polyclonal Antibody; KCNIP2 (Kv Channel-interacting Protein 2; KChIP2; A-type Potassium Channel Modulatory Protein 2; Cardiac Voltage-gated Potassium Channel Modulatory Subunit; Potassium Channel-interacting Protein 2; DKFZp566L1246; MGC17241) (FITC); anti-KCNIP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human KCNIP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
270
Applicable Applications for anti-KCNIP2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human KCNIP2, aa1-270 (NP_775283.1).
Immunogen Sequence
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(KCNIP2 rabbit polyclonal antibody. WesterKCNIP2 rabbit polyclonal antibody. Western Blot analysis of KCNIP2 expression in A-431.n Blot analysis of KCNIP2 expression in human kidney.)

Western Blot (WB) (KCNIP2 rabbit polyclonal antibody. WesterKCNIP2 rabbit polyclonal antibody. Western Blot analysis of KCNIP2 expression in A-431.n Blot analysis of KCNIP2 expression in human kidney.)

Western Blot (WB)

(KCNIP2 rabbit polyclonal antibody. Western Blot analysis of KCNIP2 expression in A-431.)

Western Blot (WB) (KCNIP2 rabbit polyclonal antibody. Western Blot analysis of KCNIP2 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of KCNIP2 expression in transfected 293T cell line by KCNIP2 polyclonal antibody. Lane 1: KCNIP2 transfected lysate (30.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KCNIP2 expression in transfected 293T cell line by KCNIP2 polyclonal antibody. Lane 1: KCNIP2 transfected lysate (30.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-KCNIP2 antibody
Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and KCND3 trafficking to the cell surface.
Product Categories/Family for anti-KCNIP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Kv channel-interacting protein 2 isoform 2
NCBI Official Synonym Full Names
potassium voltage-gated channel interacting protein 2
NCBI Official Symbol
KCNIP2
NCBI Official Synonym Symbols
KCHIP2
NCBI Protein Information
Kv channel-interacting protein 2
UniProt Protein Name
Kv channel-interacting protein 2
UniProt Gene Name
KCNIP2
UniProt Synonym Gene Names
KCHIP2; KChIP2
UniProt Entry Name
KCIP2_HUMAN

NCBI Description

This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

KCNIP2: Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND2/Kv4.2 and KCND3/Kv4.3 currents. Involved in KCND2 and KCND3 trafficking to the cell surface. Belongs to the recoverin family. 9 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 10q24

Cellular Component: voltage-gated potassium channel complex; cytoplasm

Molecular Function: identical protein binding; protein binding; potassium channel regulator activity; protein N-terminus binding; calcium ion binding; ER retention sequence binding; A-type (transient outward) potassium channel activity

Biological Process: synaptic transmission; muscle contraction; clustering of voltage-gated potassium channels; detection of calcium ion; signal transduction; regulation of heart contraction; potassium ion transport

Research Articles on KCNIP2

Similar Products

Product Notes

The KCNIP2 kcnip2 (Catalog #AAA6383457) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNIP2 (Kv Channel-interacting Protein 2, KChIP2, A-type Potassium Channel Modulatory Protein 2, Cardiac Voltage-gated Potassium Channel Modulatory Subunit, Potassium Channel-interacting Protein 2, DKFZp566L1246, MGC17241) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KCNIP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KCNIP2 kcnip2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCNIP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.