Western Blot (WB)
(Western Blot detection against Immunogen (59.55kD).)
Mouse anti-Human KATNBL1 Monoclonal Antibody | anti-katnbl1 antibody
KATNBL1 (KATNB1-like Protein 1, Katanin p80 Subunit B-like 1, C15orf29, FLJ22557, MGC117356)
Gene Names
katnbl1; fc76b10; wu:fc76b10; zgc:103491; si:ch211-150c22.2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
AscitesAscites
Synonyms
KATNBL1; Monoclonal Antibody; KATNBL1 (KATNB1-like Protein 1; Katanin p80 Subunit B-like 1; C15orf29; FLJ22557; MGC117356); Anti -KATNBL1 (KATNB1-like Protein 1; anti-katnbl1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
1E7
Specificity
Recognizes human C15orf29.
Purity/Purification
Ascites
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
MASETHNVKKRNFCNKIEDHFIDLPRKKISNFTNKNMKEVKKSPKQLAAYINRTVGQTVKSPDKLRKVIYRRKKVHHPFPNPCYRKKQSPGSGGCDMANKENELACAGHLPEKLHHDSRTYLVNSSDSGSSQTESPSSKYSGFFSEVSQDHETMAQVLFSRNMRLNVALTFWRKRSISELVAYLLRIEDLGVVVDCLPVLTNCLQEEKQYISLGCCVDLLPLVKSLLKSKFEEYVIVGLNWLQAVIKRWWSELSSKTEIINDGNIQILKQQLSGLWEQENHLTLVPGYTGNIAKDVDAYLLQLH
Applicable Applications for anti-katnbl1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-305 from human C15orf29 (AAH26234) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (59.55kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (59.55kD).)
Product Categories/Family for anti-katnbl1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
katanin p80 subunit B-like 1
NCBI Official Synonym Full Names
katanin p80 subunit B-like 1
NCBI Official Symbol
katnbl1
NCBI Official Synonym Symbols
fc76b10; wu:fc76b10; zgc:103491; si:ch211-150c22.2
NCBI Protein Information
katanin p80 subunit B-like 1
Protein Family
Similar Products
Product Notes
The katnbl1 (Catalog #AAA6002150) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KATNBL1 (KATNB1-like Protein 1, Katanin p80 Subunit B-like 1, C15orf29, FLJ22557, MGC117356) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KATNBL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the katnbl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASETHNVKK RNFCNKIEDH FIDLPRKKIS NFTNKNMKEV KKSPKQLAAY INRTVGQTVK SPDKLRKVIY RRKKVHHPFP NPCYRKKQSP GSGGCDMANK ENELACAGHL PEKLHHDSRT YLVNSSDSGS SQTESPSSKY SGFFSEVSQD HETMAQVLFS RNMRLNVALT FWRKRSISEL VAYLLRIEDL GVVVDCLPVL TNCLQEEKQY ISLGCCVDLL PLVKSLLKSK FEEYVIVGLN WLQAVIKRWW SELSSKTEII NDGNIQILKQ QLSGLWEQEN HLTLVPGYTG NIAKDVDAYL LQLH. It is sometimes possible for the material contained within the vial of "KATNBL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
