Western Blot (WB)
(Western Blot detection against Immunogen (68.31kD).)
Mouse anti-Human C2orf62 Monoclonal Antibody | anti-C2orf62 antibody
C2orf62 (Uncharacterized Protein C2orf62, Chromosome 2 Open Reading Frame 62, MGC50811)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
C2orf62; Monoclonal Antibody; C2orf62 (Uncharacterized Protein C2orf62; Chromosome 2 Open Reading Frame 62; MGC50811); Anti -C2orf62 (Uncharacterized Protein C2orf62; anti-C2orf62 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C3
Specificity
Recognizes human MGC50811.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSSKVYSTGSRAKDHQPSGPECLPLPEANAEAIDFLSSLHKEELQMLFFSETLAMVSDTGEPQGELTIEVQRGKYQEKLGMLTYCLFVHASSRGFLDKMLCGNSLLGYLSEKLELMEQHSQDFIKFLILPMERKMSLLKQDDQLAVTRSIKEGEEVKTGVTSFPWSSIKGFISEAANLVLLRVMAWRRMVPSNARFLTLDTEGKLCYLTYQNLGFQTIQVDHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLA
Applicable Applications for anti-C2orf62 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant protein corresponding to aa1-387 from human MGC50811 (AAH52750) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (68.31kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (68.31kD).)
Product Categories/Family for anti-C2orf62 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
43,900 Da
NCBI Official Full Name
Chromosome 2 open reading frame 62
NCBI Official Synonym Full Names
chromosome 2 open reading frame 62
NCBI Official Symbol
C2orf62
NCBI Protein Information
uncharacterized protein C2orf62
UniProt Protein Name
Uncharacterized protein C2orf62
UniProt Gene Name
C2orf62
UniProt Entry Name
CB062_HUMAN
Uniprot Description
CATIP: Plays a role in primary ciliogenesis by modulating actin polymerization. Belongs to the CATIP family. Interacts with TTC17
Chromosomal Location of Human Ortholog: 2q35
Cellular Component: cytoplasm; plasma membrane; nucleus; actin cytoskeleton
Molecular Function: calmodulin binding; protein binding
Biological Process: actin filament polymerization
Similar Products
Product Notes
The C2orf62 c2orf62 (Catalog #AAA6009758) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The C2orf62 (Uncharacterized Protein C2orf62, Chromosome 2 Open Reading Frame 62, MGC50811) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C2orf62 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the C2orf62 c2orf62 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSSKVYSTGS RAKDHQPSGP ECLPLPEANA EAIDFLSSLH KEELQMLFFS ETLAMVSDTG EPQGELTIEV QRGKYQEKLG MLTYCLFVHA SSRGFLDKML CGNSLLGYLS EKLELMEQHS QDFIKFLILP MERKMSLLKQ DDQLAVTRSI KEGEEVKTGV TSFPWSSIKG FISEAANLVL LRVMAWRRMV PSNARFLTLD TEGKLCYLTY QNLGFQTIQV DHQQAEVFIV EQTVHAEEGI PMSCQYYLLS DGHLA. It is sometimes possible for the material contained within the vial of "C2orf62, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
